Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	No hit found
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10005948 [exp] 92 / 5e-26 ND 85 / 5e-23 Lus10029450 [exp] 78 / 5e-21 ND 87 / 6e-25 Lus10014028 [exp] 57 / 8e-13 AT3G05880 84 / 5e-24 RARE-COLD-INDUCIBLE 2A, Low temperature and salt responsive protein family (.1) Lus10019890 [exp] 53 / 2e-11 AT3G05880 85 / 3e-24 RARE-COLD-INDUCIBLE 2A, Low temperature and salt responsive protein family (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.005G002250 [exp] 51 / 1e-10 AT3G05890 66 / 2e-16 RARE-COLD-INDUCIBLE 2B, Low temperature and salt responsive protein family (.1) Potri.013G001600 [exp] 49 / 7e-10 AT3G05880 70 / 3e-18 RARE-COLD-INDUCIBLE 2A, Low temperature and salt responsive protein family (.1) Potri.005G002100 [exp] 49 / 1e-09 AT3G05880 68 / 1e-17 RARE-COLD-INDUCIBLE 2A, Low temperature and salt responsive protein family (.1)
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10029449 pacid=23149394 polypeptide=Lus10029449 locus=Lus10029449.g ID=Lus10029449.BGIv1.0 annot-version=v1.0 ATGATGATGATGAGGTCACTTGGTTATGGCGTAGATGGCGTAGATGATGCCAGGGATGTATCCAAGGATGGTGAGGAGCAAGCAGATCCAGAACTCAACC TGGCAGCCGAACTTGAGGAACACACCCAGAGGAGGCAACAGGATCGCCAGGATTATGTCTATGCAATTAGCGGTGCCCATAATTGA
AA sequence Show only first row Show all	>Lus10029449 pacid=23149394 polypeptide=Lus10029449 locus=Lus10029449.g ID=Lus10029449.BGIv1.0 annot-version=v1.0 MMMMRSLGYGVDGVDDARDVSKDGEEQADPELNLAAELEEHTQRRQQDRQDYVYAISGAHN

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
					Lus10029449 [exp]	0	1
AT5G65550			UDP-Glycosyltransferase superf...		Lus10043445 [exp]	1.4	0.8848
AT2G22560			Kinase interacting (KIP1-like)...		Lus10012730 [exp]	1.7	0.8819
AT5G26250			Major facilitator superfamily ...		Lus10041212 [exp]	2.4	0.8925
AT1G01900		SBTI1.1, ATSBT1...	subtilase family protein (.1)		Lus10003663 [exp]	4.7	0.8537
					Lus10010449 [exp]	5.7	0.8440
AT4G13450			Adenine nucleotide alpha hydro...		Lus10014459 [exp]	6.5	0.8587
AT4G19380			Long-chain fatty alcohol dehyd...		Lus10037257 [exp]	6.5	0.8497
AT1G69840			SPFH/Band 7/PHB domain-contain...		Lus10037213 [exp]	7.1	0.8554
AT5G18310			unknown protein		Lus10042520 [exp]	7.2	0.8500
					Lus10039781 [exp]	10.4	0.8670

Compare expression of checked genes

Lus10029449 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.