Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT3G05890 40 / 2e-06 RCI2B RARE-COLD-INDUCIBLE 2B, Low temperature and salt responsive protein family (.1) AT2G38905 39 / 1e-05 Low temperature and salt responsive protein family (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10005948 [exp] 104 / 7e-31 ND 85 / 5e-23 Lus10029449 [exp] 96 / 2e-28 ND 89 / 1e-25 Lus10014028 [exp] 72 / 1e-18 AT3G05880 84 / 5e-24 RARE-COLD-INDUCIBLE 2A, Low temperature and salt responsive protein family (.1) Lus10019890 [exp] 68 / 3e-17 AT3G05880 85 / 3e-24 RARE-COLD-INDUCIBLE 2A, Low temperature and salt responsive protein family (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.005G002250 [exp] 65 / 6e-16 AT3G05890 66 / 2e-16 RARE-COLD-INDUCIBLE 2B, Low temperature and salt responsive protein family (.1) Potri.005G002100 [exp] 55 / 4e-12 AT3G05880 68 / 1e-17 RARE-COLD-INDUCIBLE 2A, Low temperature and salt responsive protein family (.1) Potri.013G001600 [exp] 54 / 9e-12 AT3G05880 70 / 3e-18 RARE-COLD-INDUCIBLE 2A, Low temperature and salt responsive protein family (.1)
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10029450 pacid=23149467 polypeptide=Lus10029450 locus=Lus10029450.g ID=Lus10029450.BGIv1.0 annot-version=v1.0 ATGATGATGAAGACTTCACTTGGTGATGGCGTAGATGGCGTAGATGATGCCAGGGAGGTAGCCAAAGATAGTGAGGAGCAAACAGATCCAGAACTCTACA TGACAACCGAACTTGAGGAACACACCCAGAGGCGGCAAAAGGATCGCCAGGATTATGTCTACGCAATTAGCGGTGCCCTCCTTCATGACGATATTGATTG A
AA sequence Show only first row Show all	>Lus10029450 pacid=23149467 polypeptide=Lus10029450 locus=Lus10029450.g ID=Lus10029450.BGIv1.0 annot-version=v1.0 MMMKTSLGDGVDGVDDAREVAKDSEEQTDPELYMTTELEEHTQRRQKDRQDYVYAISGALLHDDID

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
					Lus10029450 [exp]	0	1
AT1G55020		ATLOX1, LOX1	ARABIDOPSIS LIPOXYGENASE 1, li...		Lus10008202 [exp]	2.0	0.8954
AT3G53810			Concanavalin A-like lectin pro...		Lus10004980 [exp]	3.2	0.9136
AT4G12570		UPL5	ubiquitin protein ligase 5 (.1...		Lus10003792 [exp]	3.3	0.9195
AT2G39370		MAKR4	MEMBRANE-ASSOCIATED KINASE REG...		Lus10030311 [exp]	5.2	0.8399
					Lus10036436 [exp]	6.9	0.9060
AT5G56170		LLG1	LORELEI-LIKE-GPI-ANCHORED PROT...		Lus10027120 [exp]	8.0	0.8548
AT3G53810			Concanavalin A-like lectin pro...		Lus10001564 [exp]	10.6	0.8569
AT4G19380			Long-chain fatty alcohol dehyd...		Lus10035673 [exp]	16.2	0.8608
					Lus10024547 [exp]	20.1	0.8081
AT3G27210			unknown protein		Lus10035217 [exp]	32.2	0.8251

Compare expression of checked genes

Lus10029450 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.