Lus10029461 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT5G59850 263 / 1e-92 Ribosomal protein S8 family protein (.1)
AT1G07770 263 / 1e-92 RPS15A ribosomal protein S15A (.1.2)
AT3G46040 262 / 3e-92 RPS15AD ribosomal protein S15A D (.1)
AT2G39590 247 / 3e-86 Ribosomal protein S8 family protein (.1)
AT4G29430 147 / 8e-47 RPS15AE ribosomal protein S15A E (.1)
AT2G19720 142 / 8e-45 RPS15AB ribosomal protein S15A B (.1)
ATCG00770 40 / 7e-05 ATCG00770.1, RPS8 ribosomal protein S8 (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10023429 267 / 7e-94 AT5G59850 264 / 9e-93 Ribosomal protein S8 family protein (.1)
Lus10040309 266 / 1e-93 AT5G59850 263 / 1e-92 Ribosomal protein S8 family protein (.1)
Lus10043001 266 / 1e-93 AT1G07770 263 / 1e-92 ribosomal protein S15A (.1.2)
Lus10032503 266 / 1e-93 AT1G07770 263 / 1e-92 ribosomal protein S15A (.1.2)
Lus10005960 266 / 1e-93 AT5G59850 263 / 1e-92 Ribosomal protein S8 family protein (.1)
Lus10040543 134 / 1e-41 AT4G29430 236 / 4e-82 ribosomal protein S15A E (.1)
Lus10000975 134 / 2e-41 AT4G29430 235 / 2e-81 ribosomal protein S15A E (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.010G208700 259 / 5e-91 AT5G59850 260 / 2e-91 Ribosomal protein S8 family protein (.1)
Potri.001G118100 259 / 5e-91 AT5G59850 260 / 2e-91 Ribosomal protein S8 family protein (.1)
Potri.003G114800 259 / 5e-91 AT5G59850 260 / 2e-91 Ribosomal protein S8 family protein (.1)
Potri.008G051900 257 / 4e-90 AT5G59850 260 / 2e-91 Ribosomal protein S8 family protein (.1)
Potri.009G071250 135 / 7e-42 AT4G29430 228 / 6e-79 ribosomal protein S15A E (.1)
Potri.009G071400 135 / 7e-42 AT4G29430 228 / 6e-79 ribosomal protein S15A E (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
PF00410 Ribosomal_S8 Ribosomal protein S8
Representative CDS sequence
>Lus10029461 pacid=23149390 polypeptide=Lus10029461 locus=Lus10029461.g ID=Lus10029461.BGIv1.0 annot-version=v1.0
ATGGTGAGGATTAGCGTTTTGAACGATGCTCTTAAGAGCATGTACAATGCAGAGAAGCGTGGTAAGCGCCAGGTCATGATCAGGCCTTCCTCGAAAGTGA
TCATCAAGTTTCTTATTGTGATGCAGAAACATGGATACATTGGTGAGTTTGAATATGTTGATGACCACAGAGCTGGCAAAATTGTTGTGGAGTTGAATGG
AAGGCTGAACAAATGTGGTGTCATCAGCCCGAGATTTGACATTGGTGTCAAGGAGATCGAAGGCTGGACTGCTCGCTTGCTTCCATCTAGACAGTTTGGA
TTCATTGTGTTGACAACTTCTGCTGGCATTATGGACCACGAGGAAGCAAGAAGGAAGAATGTTGGAGGGAAAGTGCTTGGCTTCTTCTACTAA
AA sequence
>Lus10029461 pacid=23149390 polypeptide=Lus10029461 locus=Lus10029461.g ID=Lus10029461.BGIv1.0 annot-version=v1.0
MVRISVLNDALKSMYNAEKRGKRQVMIRPSSKVIIKFLIVMQKHGYIGEFEYVDDHRAGKIVVELNGRLNKCGVISPRFDIGVKEIEGWTARLLPSRQFG
FIVLTTSAGIMDHEEARRKNVGGKVLGFFY

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT5G59850 Ribosomal protein S8 family pr... Lus10029461 0 1
AT5G59850 Ribosomal protein S8 family pr... Lus10005960 1.0 0.9897
AT4G29410 Ribosomal L28e protein family ... Lus10032699 3.5 0.9591
AT1G16470 PAB1 proteasome subunit PAB1 (.1.2) Lus10036210 4.2 0.9156
AT1G26880 Ribosomal protein L34e superfa... Lus10037177 4.6 0.9519
AT5G23535 KOW domain-containing protein ... Lus10022069 6.0 0.9347
AT5G12110 Glutathione S-transferase, C-t... Lus10026784 7.5 0.9198
AT3G62870 Ribosomal protein L7Ae/L30e/S1... Lus10035650 7.7 0.9422
AT3G61110 ARS27A ribosomal protein S27 (.1) Lus10031979 8.4 0.9362
AT5G47320 RPS19 ribosomal protein S19 (.1) Lus10027711 11.0 0.8986
AT4G26210 Mitochondrial ATP synthase sub... Lus10001771 12.2 0.9284

Lus10029461 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.