Lus10029466 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT1G05675 186 / 4e-57 UDP-Glycosyltransferase superfamily protein (.1)
AT1G05680 184 / 1e-56 UGT74E2 Uridine diphosphate glycosyltransferase 74E2 (.1)
AT2G31750 168 / 3e-50 UGT74D1 UDP-glucosyl transferase 74D1 (.1)
AT2G31790 166 / 2e-49 UDP-Glycosyltransferase superfamily protein (.1)
AT2G43820 162 / 7e-48 SGT1, ATSAGT1, GT, UGT74F2 UDP-glucose:salicylic acid glucosyltransferase 1, Arabidopsis thaliana salicylic acid glucosyltransferase 1, UDP-glucosyltransferase 74F2 (.1)
AT1G24100 156 / 7e-46 UGT74B1 UDP-glucosyl transferase 74B1 (.1)
AT2G43840 156 / 8e-46 UGT74F1 UDP-glycosyltransferase 74 F1 (.1.2)
AT4G14090 134 / 2e-37 UDP-Glycosyltransferase superfamily protein (.1)
AT1G05560 128 / 3e-35 UGT75B1, UGT1 UDP-GLUCOSE TRANSFERASE 1, UDP-glucosyltransferase 75B1 (.1)
AT1G05530 124 / 2e-33 UGT75B2, UGT2 UDP-GLUCOSYL TRANSFERASE 2, UDP-glucosyl transferase 75B2 (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10024117 290 / 4e-97 AT1G05675 385 / 4e-130 UDP-Glycosyltransferase superfamily protein (.1)
Lus10024118 183 / 6e-56 AT1G05675 375 / 2e-126 UDP-Glycosyltransferase superfamily protein (.1)
Lus10008742 177 / 1e-53 AT2G43840 478 / 6e-167 UDP-glycosyltransferase 74 F1 (.1.2)
Lus10010468 173 / 3e-52 AT1G05675 368 / 7e-124 UDP-Glycosyltransferase superfamily protein (.1)
Lus10006351 166 / 1e-50 AT1G05680 315 / 9e-106 Uridine diphosphate glycosyltransferase 74E2 (.1)
Lus10029469 164 / 2e-50 AT1G05680 136 / 5e-37 Uridine diphosphate glycosyltransferase 74E2 (.1)
Lus10006721 165 / 3e-49 AT2G43820 392 / 9e-134 UDP-glucose:salicylic acid glucosyltransferase 1, Arabidopsis thaliana salicylic acid glucosyltransferase 1, UDP-glucosyltransferase 74F2 (.1)
Lus10039041 164 / 1e-48 AT1G05675 343 / 3e-114 UDP-Glycosyltransferase superfamily protein (.1)
Lus10006352 161 / 1e-47 AT2G43820 414 / 6e-142 UDP-glucose:salicylic acid glucosyltransferase 1, Arabidopsis thaliana salicylic acid glucosyltransferase 1, UDP-glucosyltransferase 74F2 (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.017G032500 186 / 4e-57 AT1G05680 446 / 1e-154 Uridine diphosphate glycosyltransferase 74E2 (.1)
Potri.017G032300 186 / 5e-57 AT1G05675 465 / 6e-162 UDP-Glycosyltransferase superfamily protein (.1)
Potri.017G032700 183 / 7e-56 AT1G05680 444 / 6e-154 Uridine diphosphate glycosyltransferase 74E2 (.1)
Potri.017G032733 183 / 7e-56 AT1G05680 444 / 6e-154 Uridine diphosphate glycosyltransferase 74E2 (.1)
Potri.001G389200 182 / 2e-55 AT1G05680 494 / 2e-173 Uridine diphosphate glycosyltransferase 74E2 (.1)
Potri.004G179300 176 / 4e-53 AT1G05680 446 / 1e-154 Uridine diphosphate glycosyltransferase 74E2 (.1)
Potri.007G140300 172 / 8e-52 AT1G05680 457 / 4e-159 Uridine diphosphate glycosyltransferase 74E2 (.1)
Potri.014G175000 170 / 4e-51 AT2G43840 411 / 8e-141 UDP-glycosyltransferase 74 F1 (.1.2)
Potri.015G071900 169 / 7e-51 AT1G24100 427 / 5e-147 UDP-glucosyl transferase 74B1 (.1)
Potri.007G117200 169 / 1e-50 AT2G43840 461 / 1e-160 UDP-glycosyltransferase 74 F1 (.1.2)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0113 GT-B PF00201 UDPGT UDP-glucoronosyl and UDP-glucosyl transferase
Representative CDS sequence
>Lus10029466 pacid=23149473 polypeptide=Lus10029466 locus=Lus10029466.g ID=Lus10029466.BGIv1.0 annot-version=v1.0
ATGGGCAGTAAGCTGAAATTCAAGACAGTGGGACCCACTGTCCCATCAATCTACTTGGGCAAGCAGCACCAGCCCCATGACGACGACACCTTGGAGGACC
ATCACGAGTATGGTCTTAGCCTCTTCCAGTCACAATCTCCAACTCGCCTCATTAATTGGCTCAACTCCCAACTTCCCCAATCTGTCATTTACGTTTCATT
CGAAAGGCTGGTGGTGTCCTGGTGCTGCCAACTAGAGGTGCTGGCCCACAAATCCATCGGATGCTTCGTGATTCACTATGGGTGTGGGTGGAACTCGACT
ATCGAGGCGTTGAGTTTGGGAGTGTCGATGGTTGGGGTGCCGCAATTTGCAGATCAGTTGACCAACGCCAAATTTGTGGAAGACGTGTGGAAAGTAGGGG
TGAGAGTGAAGAATTCAGAATTAGGGATAGTGAGGAAGGAAGAGATAAAGAAAGGGATACTTGAAGCGATGGAAGGGGAGAGAGCGAAGGATATTAGAAT
GAATGCCGAGAAATGGAAGAGTCTTGCTCAAGCAGCCGTTGCTAATGGAAGAACTTCCGACAATAATATTTAG
AA sequence
>Lus10029466 pacid=23149473 polypeptide=Lus10029466 locus=Lus10029466.g ID=Lus10029466.BGIv1.0 annot-version=v1.0
MGSKLKFKTVGPTVPSIYLGKQHQPHDDDTLEDHHEYGLSLFQSQSPTRLINWLNSQLPQSVIYVSFERLVVSWCCQLEVLAHKSIGCFVIHYGCGWNST
IEALSLGVSMVGVPQFADQLTNAKFVEDVWKVGVRVKNSELGIVRKEEIKKGILEAMEGERAKDIRMNAEKWKSLAQAAVANGRTSDNNI

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT1G05675 UDP-Glycosyltransferase superf... Lus10029466 0 1

Lus10029466 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.