Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT5G15920 76 / 5e-17 EMB2782, SMC5 EMBRYO DEFECTIVE 2782, structural maintenance of chromosomes 5 (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10029476 [exp] 195 / 6e-59 AT5G15920 1172 / 0.0 EMBRYO DEFECTIVE 2782, structural maintenance of chromosomes 5 (.1) Lus10039590 [exp] 193 / 4e-58 AT5G15920 1175 / 0.0 EMBRYO DEFECTIVE 2782, structural maintenance of chromosomes 5 (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.001G262600 [exp] 96 / 5e-24 AT5G15920 1427 / 0.0 EMBRYO DEFECTIVE 2782, structural maintenance of chromosomes 5 (.1)
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10029473 pacid=23149388 polypeptide=Lus10029473 locus=Lus10029473.g ID=Lus10029473.BGIv1.0 annot-version=v1.0 ATGGACAGCCTGGCACTTTGTAATTTGCAGGAAGAAATTACCAGAGAGGCACAGCATGAAACCCAAAAACGACTCGAGTTGCAAAATCGCATAGATCGAA AGAAAAGAGAGTTACAATCTCTGAAGAATGGAAGTGACTTAGAGCGACGGATGGCAAGTCTTATAGATGATGCAAGAAAGATTAACATTCAGCGGGTACA ATGTGCAAAGGAAATGAAGAACTTGCTTCTTGAGGCAGTTTCATGCAAACGGAGCTATGCGGCAATAGAAATGGCCTCTATTGAGTTTGATGGGAAGGTC AGTGAAATGGAGATCAAGCAGAAGGAGCATAAAATGGTCGCAGAGCAAGCAGCGGTTCATCTTCAACACTGTTAG
AA sequence Show only first row Show all	>Lus10029473 pacid=23149388 polypeptide=Lus10029473 locus=Lus10029473.g ID=Lus10029473.BGIv1.0 annot-version=v1.0 MDSLALCNLQEEITREAQHETQKRLELQNRIDRKKRELQSLKNGSDLERRMASLIDDARKINIQRVQCAKEMKNLLLEAVSCKRSYAAIEMASIEFDGKV SEMEIKQKEHKMVAEQAAVHLQHC

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT5G15920		EMB2782, SMC5	EMBRYO DEFECTIVE 2782, structu...		Lus10029473 [exp]	0	1
AT1G18720			Protein of unknown function (D...		Lus10001647 [exp]	13.7	0.8858
					Lus10025056 [exp]	19.4	0.8858
AT3G26140			Cellulase (glycosyl hydrolase ...		Lus10032312 [exp]	23.8	0.8858
AT4G14570		AtAARE, AARE	acylamino acid-releasing enzym...		Lus10006641 [exp]	25.2	0.8537
					Lus10007403 [exp]	27.5	0.8858
AT2G21720			Plant protein of unknown funct...		Lus10007431 [exp]	30.7	0.8858
AT5G26330			Cupredoxin superfamily protein...		Lus10006680 [exp]	33.7	0.8858
AT5G12460			Protein of unknown function (D...		Lus10003179 [exp]	36.4	0.8858
					Lus10003763 [exp]	38.9	0.8858
					Lus10006079 [exp]	41.2	0.8858

Compare expression of checked genes

Lus10029473 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.