Lus10029478 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT5G48350 82 / 2e-19 Polynucleotidyl transferase, ribonuclease H-like superfamily protein (.1)
AT3G12410 81 / 9e-19 Polynucleotidyl transferase, ribonuclease H-like superfamily protein (.1)
AT4G13870 75 / 3e-16 WRNEXO, ATWRNEXO, WEX, ATWEX Werner syndrome-like exonuclease (.1.2)
AT2G36110 69 / 2e-14 Polynucleotidyl transferase, ribonuclease H-like superfamily protein (.1)
AT3G12470 66 / 3e-13 Polynucleotidyl transferase, ribonuclease H-like superfamily protein (.1)
AT1G56310 67 / 7e-13 Polynucleotidyl transferase, ribonuclease H-like superfamily protein (.1)
AT3G12460 63 / 4e-12 Polynucleotidyl transferase, ribonuclease H-like superfamily protein (.1)
AT3G62320 55 / 1e-09 Polynucleotidyl transferase, ribonuclease H-like superfamily protein (.1)
AT3G12420 54 / 3e-09 Polynucleotidyl transferase, ribonuclease H-like superfamily protein (.1)
AT3G12430 54 / 6e-09 Polynucleotidyl transferase, ribonuclease H-like superfamily protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10039591 338 / 4e-120 AT3G12410 86 / 1e-20 Polynucleotidyl transferase, ribonuclease H-like superfamily protein (.1)
Lus10029479 201 / 4e-66 AT2G36110 87 / 4e-21 Polynucleotidyl transferase, ribonuclease H-like superfamily protein (.1)
Lus10039164 144 / 3e-43 AT4G13870 105 / 2e-27 Werner syndrome-like exonuclease (.1.2)
Lus10013769 142 / 2e-42 AT4G13870 105 / 4e-27 Werner syndrome-like exonuclease (.1.2)
Lus10043049 90 / 4e-22 AT2G36110 121 / 4e-34 Polynucleotidyl transferase, ribonuclease H-like superfamily protein (.1)
Lus10010357 62 / 2e-11 AT3G11770 66 / 7e-13 Polynucleotidyl transferase, ribonuclease H-like superfamily protein (.1)
Lus10036491 61 / 3e-11 AT3G11770 64 / 4e-12 Polynucleotidyl transferase, ribonuclease H-like superfamily protein (.1)
Lus10010930 59 / 3e-10 AT1G56310 640 / 0.0 Polynucleotidyl transferase, ribonuclease H-like superfamily protein (.1)
Lus10022556 53 / 3e-08 AT4G13870 246 / 1e-80 Werner syndrome-like exonuclease (.1.2)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.016G028700 121 / 2e-34 AT4G13870 104 / 5e-27 Werner syndrome-like exonuclease (.1.2)
Potri.011G116000 118 / 2e-33 AT3G12410 91 / 2e-22 Polynucleotidyl transferase, ribonuclease H-like superfamily protein (.1)
Potri.006G031400 117 / 6e-33 AT3G12410 101 / 2e-26 Polynucleotidyl transferase, ribonuclease H-like superfamily protein (.1)
Potri.017G059200 72 / 7e-15 AT4G13870 288 / 4e-97 Werner syndrome-like exonuclease (.1.2)
Potri.019G021900 66 / 3e-13 AT3G11770 77 / 3e-17 Polynucleotidyl transferase, ribonuclease H-like superfamily protein (.1)
Potri.005G020000 61 / 5e-11 AT1G56310 655 / 0.0 Polynucleotidyl transferase, ribonuclease H-like superfamily protein (.1)
Potri.016G028400 60 / 5e-11 ND /
Potri.016G028600 54 / 5e-09 ND /
Potri.006G031300 49 / 3e-07 ND /
Potri.013G049000 48 / 6e-07 AT5G06450 / Polynucleotidyl transferase, ribonuclease H-like superfamily protein (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0219 RNase_H PF01612 DNA_pol_A_exo1 3'-5' exonuclease
Representative CDS sequence
>Lus10029478 pacid=23149425 polypeptide=Lus10029478 locus=Lus10029478.g ID=Lus10029478.BGIv1.0 annot-version=v1.0
ATGGCGGGTAACTACGTGAGATCGGTCTACTTCGGCGGCTACGAAATCGAAACCACGGTGGCCAACCAGGCCTATGTGGTCGCAAACTGGGTTCGATCCT
TCCCGCCCGGTCGGAAGAGGATAGTGGGACTGGACTGCGAGTGGAAGCCCTTCTTTTATAACAACCAGAACAATGTAACGGCTGTGCTGCAACTCTGCGT
CGAAACCAAGTGCATCATCATACAGATGTCCTACCTCCAATCCATCCCCCAGGCCCTGGCCGATTTCCTCCAGAATCCCAATAACTATTTCGTTGGGGTC
GGGGTGGACGCTGACGTGAGGAGGTTAACCGCAGATTACGGGCTGAGCTGCGGCTCAACTGCTGACATTCAGACCATCGCTAGGGACCAGTGGAACATGA
GGAATCTTCCTGGGCTGAAGGATATTCTATTACAGGTGGAAGGGGTTGTCATGGAGAAACCGCTGTATGTTACGAGGAGCAATTGGCAGAAGAGACAACT
TGACCCCGAGCAGGTTGAGTATGCTTGCATTGATGCTTTTGCTTCTTATAAGATCGGCTACAGTCTGCGACGCTGCATCGATTGTTTTATTTACTAG
AA sequence
>Lus10029478 pacid=23149425 polypeptide=Lus10029478 locus=Lus10029478.g ID=Lus10029478.BGIv1.0 annot-version=v1.0
MAGNYVRSVYFGGYEIETTVANQAYVVANWVRSFPPGRKRIVGLDCEWKPFFYNNQNNVTAVLQLCVETKCIIIQMSYLQSIPQALADFLQNPNNYFVGV
GVDADVRRLTADYGLSCGSTADIQTIARDQWNMRNLPGLKDILLQVEGVVMEKPLYVTRSNWQKRQLDPEQVEYACIDAFASYKIGYSLRRCIDCFIY

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT5G48350 Polynucleotidyl transferase, r... Lus10029478 0 1
AT2G39190 ATATH8 Protein kinase superfamily pro... Lus10040390 16.3 0.8134
AT3G45140 ATLOX2, LOX2 ARABIODOPSIS THALIANA LIPOXYGE... Lus10039094 29.7 0.7629
AT4G19180 GDA1/CD39 nucleoside phosphata... Lus10039953 36.5 0.7472
AT1G29910 AB180, LHCB1.2,... LIGHT HARVESTING CHLOROPHYLL A... Lus10027966 45.3 0.7741
AT3G63520 ATNCED1, ATCCD1... carotenoid cleavage dioxygenas... Lus10042829 71.2 0.7551
AT4G17810 C2H2ZnF ZFP12 C2H2 and C2HC zinc fingers sup... Lus10030967 83.7 0.7544
AT3G05950 RmlC-like cupins superfamily p... Lus10029571 89.5 0.7537
AT2G04360 unknown protein Lus10000124 136.1 0.7177
AT1G33330 Class I peptide chain release ... Lus10032675 165.0 0.6816
AT5G14120 Major facilitator superfamily ... Lus10023961 182.1 0.7151

Lus10029478 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.