Lus10029479 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT2G36110 87 / 4e-21 Polynucleotidyl transferase, ribonuclease H-like superfamily protein (.1)
AT3G12410 84 / 4e-20 Polynucleotidyl transferase, ribonuclease H-like superfamily protein (.1)
AT3G12460 81 / 1e-18 Polynucleotidyl transferase, ribonuclease H-like superfamily protein (.1)
AT3G12430 78 / 1e-17 Polynucleotidyl transferase, ribonuclease H-like superfamily protein (.1)
AT3G12470 77 / 3e-17 Polynucleotidyl transferase, ribonuclease H-like superfamily protein (.1)
AT5G48350 72 / 1e-15 Polynucleotidyl transferase, ribonuclease H-like superfamily protein (.1)
AT4G13870 71 / 1e-14 WRNEXO, ATWRNEXO, WEX, ATWEX Werner syndrome-like exonuclease (.1.2)
AT3G12440 66 / 1e-12 Polynucleotidyl transferase, ribonuclease H-like superfamily protein (.1)
AT3G12420 62 / 3e-12 Polynucleotidyl transferase, ribonuclease H-like superfamily protein (.1)
AT1G56310 55 / 6e-09 Polynucleotidyl transferase, ribonuclease H-like superfamily protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10029478 202 / 2e-66 AT5G48350 82 / 2e-19 Polynucleotidyl transferase, ribonuclease H-like superfamily protein (.1)
Lus10039591 189 / 4e-61 AT3G12410 86 / 1e-20 Polynucleotidyl transferase, ribonuclease H-like superfamily protein (.1)
Lus10039164 130 / 7e-38 AT4G13870 105 / 2e-27 Werner syndrome-like exonuclease (.1.2)
Lus10013769 126 / 2e-36 AT4G13870 105 / 4e-27 Werner syndrome-like exonuclease (.1.2)
Lus10043049 100 / 2e-26 AT2G36110 121 / 4e-34 Polynucleotidyl transferase, ribonuclease H-like superfamily protein (.1)
Lus10022556 61 / 4e-11 AT4G13870 246 / 1e-80 Werner syndrome-like exonuclease (.1.2)
Lus10010357 47 / 2e-06 AT3G11770 66 / 7e-13 Polynucleotidyl transferase, ribonuclease H-like superfamily protein (.1)
Lus10036491 47 / 2e-06 AT3G11770 64 / 4e-12 Polynucleotidyl transferase, ribonuclease H-like superfamily protein (.1)
Lus10010930 43 / 0.0001 AT1G56310 640 / 0.0 Polynucleotidyl transferase, ribonuclease H-like superfamily protein (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.016G028700 124 / 2e-35 AT4G13870 104 / 5e-27 Werner syndrome-like exonuclease (.1.2)
Potri.006G031400 123 / 4e-35 AT3G12410 101 / 2e-26 Polynucleotidyl transferase, ribonuclease H-like superfamily protein (.1)
Potri.011G116000 119 / 7e-34 AT3G12410 91 / 2e-22 Polynucleotidyl transferase, ribonuclease H-like superfamily protein (.1)
Potri.017G059200 74 / 7e-16 AT4G13870 288 / 4e-97 Werner syndrome-like exonuclease (.1.2)
Potri.013G049000 55 / 3e-09 AT5G06450 / Polynucleotidyl transferase, ribonuclease H-like superfamily protein (.1)
Potri.019G021900 50 / 2e-07 AT3G11770 77 / 3e-17 Polynucleotidyl transferase, ribonuclease H-like superfamily protein (.1)
Potri.005G020000 49 / 5e-07 AT1G56310 655 / 0.0 Polynucleotidyl transferase, ribonuclease H-like superfamily protein (.1)
Potri.016G028400 43 / 3e-05 ND /
Potri.002G185500 42 / 0.0001 AT3G12410 45 / 1e-05 Polynucleotidyl transferase, ribonuclease H-like superfamily protein (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0219 RNase_H PF01612 DNA_pol_A_exo1 3'-5' exonuclease
Representative CDS sequence
>Lus10029479 pacid=23149423 polypeptide=Lus10029479 locus=Lus10029479.g ID=Lus10029479.BGIv1.0 annot-version=v1.0
ATGGCAGGCAACAGCATGAAAATCATCCACTTCTCCGGCAGCGACATAGAAACGACTGTGACCGACAAAGCTTCCGACATCGACGCCTGGGTTCGATCCG
TCAGGACGGGCCATAAACTGATCGTTGGGCTTGACTGCGAGTGGAGGCCCAACACCACGATATTCATGAACAACAAAGTTGCCCTCCTACAGCTCTGTGT
TGGAACAAAGTGCCTCATCATCCAGCTCTTCTACCTTGACCTCATTCCCCAGTCCATGAAGGATTTCCTCCGAGACTCTAATCACACTTTCGTTGGTGTT
GAGGTGGCCCGAGATGCGTCCAAGCTGAATGCAGACTACGGGCTGAGGTGTACAACTGTATCTGACGTGCGCGAGATCACTATGGCGAGATGGCCTCACA
AGTTCTGGGATAAGCCTGGGCTAAAGGATGTTGCCCTCATAGTTTCGGGGCTTAGAATGCCCAAACAGAAGTATGTTTCCAGGAGTGATTGGCAGAAGAG
GCTGCTTGATGACATTCAGATCGAGTATGCTTGTATTGATGCTTTTGCCTCTTCTAGGATTGCCCGTGATTTGGGTATCTGA
AA sequence
>Lus10029479 pacid=23149423 polypeptide=Lus10029479 locus=Lus10029479.g ID=Lus10029479.BGIv1.0 annot-version=v1.0
MAGNSMKIIHFSGSDIETTVTDKASDIDAWVRSVRTGHKLIVGLDCEWRPNTTIFMNNKVALLQLCVGTKCLIIQLFYLDLIPQSMKDFLRDSNHTFVGV
EVARDASKLNADYGLRCTTVSDVREITMARWPHKFWDKPGLKDVALIVSGLRMPKQKYVSRSDWQKRLLDDIQIEYACIDAFASSRIARDLGI

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT2G36110 Polynucleotidyl transferase, r... Lus10029479 0 1
AT2G19560 ESSP1, AtTHP1, ... ectopic expression of seed sto... Lus10032680 3.2 0.7717
AT1G67120 ATPases;nucleotide binding;ATP... Lus10037616 5.1 0.7744
AT1G68030 RING/FYVE/PHD zinc finger supe... Lus10011320 8.4 0.7547
AT5G04270 DHHC-type zinc finger family p... Lus10037973 9.2 0.7020
AT5G22460 alpha/beta-Hydrolases superfam... Lus10020603 10.6 0.7478
AT3G11620 BAS1 alpha/beta-Hydrolases superfam... Lus10016975 12.7 0.7067
AT1G01020 ARV1 Arv1-like protein (.1.2) Lus10007219 13.0 0.7400
AT5G64390 HEN4 HUA ENHANCER 4, RNA-binding KH... Lus10028237 14.9 0.7331
AT5G37590 Tetratricopeptide repeat (TPR)... Lus10004036 16.2 0.7097
AT1G31480 SGR2 shoot gravitropism 2 (SGR2) (.... Lus10002946 18.2 0.7674

Lus10029479 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.