Lus10029486 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT2G39980 50 / 2e-08 HXXXD-type acyl-transferase family protein (.1)
AT5G01210 49 / 9e-08 HXXXD-type acyl-transferase family protein (.1)
AT3G50290 47 / 2e-07 HXXXD-type acyl-transferase family protein (.1)
AT3G50280 46 / 6e-07 HXXXD-type acyl-transferase family protein (.1)
AT5G67150 45 / 1e-06 HXXXD-type acyl-transferase family protein (.1)
AT5G67160 44 / 4e-06 EPS1 ENHANCED PSEUDOMONAS SUSCEPTIBILTY 1, HXXXD-type acyl-transferase family protein (.1)
AT5G42830 43 / 9e-06 HXXXD-type acyl-transferase family protein (.1)
AT3G50300 41 / 5e-05 HXXXD-type acyl-transferase family protein (.1)
AT5G23940 40 / 6e-05 PEL3, DCR, EMB3009 PERMEABLE LEAVES3, EMBRYO DEFECTIVE 3009, DEFECTIVE IN CUTICULAR RIDGES, HXXXD-type acyl-transferase family protein (.1)
AT3G50270 40 / 8e-05 HXXXD-type acyl-transferase family protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10031725 61 / 5e-12 AT3G50300 198 / 2e-59 HXXXD-type acyl-transferase family protein (.1)
Lus10031148 58 / 6e-11 AT5G67150 284 / 5e-91 HXXXD-type acyl-transferase family protein (.1)
Lus10031149 56 / 3e-10 AT3G50280 305 / 3e-99 HXXXD-type acyl-transferase family protein (.1)
Lus10041591 50 / 5e-08 AT5G67150 347 / 2e-115 HXXXD-type acyl-transferase family protein (.1)
Lus10040222 47 / 3e-07 AT2G39980 633 / 0.0 HXXXD-type acyl-transferase family protein (.1)
Lus10028267 47 / 3e-07 AT2G39980 631 / 0.0 HXXXD-type acyl-transferase family protein (.1)
Lus10027779 46 / 1e-06 AT5G01210 350 / 7e-119 HXXXD-type acyl-transferase family protein (.1)
Lus10024809 43 / 1e-05 AT5G42830 442 / 8e-153 HXXXD-type acyl-transferase family protein (.1)
Lus10027500 40 / 7e-05 AT5G23940 571 / 0.0 PERMEABLE LEAVES3, EMBRYO DEFECTIVE 3009, DEFECTIVE IN CUTICULAR RIDGES, HXXXD-type acyl-transferase family protein (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.016G112400 53 / 2e-09 AT5G01210 614 / 0.0 HXXXD-type acyl-transferase family protein (.1)
Potri.003G057100 52 / 5e-09 AT3G50280 303 / 4e-99 HXXXD-type acyl-transferase family protein (.1)
Potri.006G097500 52 / 5e-09 AT5G01210 633 / 0.0 HXXXD-type acyl-transferase family protein (.1)
Potri.003G057001 52 / 6e-09 AT5G67150 275 / 3e-88 HXXXD-type acyl-transferase family protein (.1)
Potri.003G057200 51 / 1e-08 AT5G67150 297 / 1e-96 HXXXD-type acyl-transferase family protein (.1)
Potri.010G192400 49 / 1e-07 AT2G39980 708 / 0.0 HXXXD-type acyl-transferase family protein (.1)
Potri.008G065000 47 / 3e-07 AT2G39980 705 / 0.0 HXXXD-type acyl-transferase family protein (.1)
Potri.014G025600 45 / 1e-06 AT5G42830 565 / 0.0 HXXXD-type acyl-transferase family protein (.1)
Potri.014G025550 45 / 1e-06 AT5G42830 579 / 0.0 HXXXD-type acyl-transferase family protein (.1)
Potri.014G025500 45 / 1e-06 AT5G42830 576 / 0.0 HXXXD-type acyl-transferase family protein (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0149 CoA-acyltrans PF02458 Transferase Transferase family
Representative CDS sequence
>Lus10029486 pacid=23149452 polypeptide=Lus10029486 locus=Lus10029486.g ID=Lus10029486.BGIv1.0 annot-version=v1.0
ATGGCACAACCTCTATCTACATCGACCGCAACAACGCCAGCGCTCTGTTCATCCACGCCGTTGCTAACTCCATCTCTATCACTGATATCCTGGAGCCTCT
CAATGTCCCTCCCGTTCTTTGGTCCTTCTTCCCACTCAATCGGCGTCAAAATTTGTCACGGATTCTCCCAGCCACTTCTTGCAGTCCAGATTACAGAGCT
CGTCAACGGGATCTTCATCGGGTGCACGATTAGCTATGCTGTGGCCGATGGTACTACAGCAGGAGTTGAAAGAGCGAGTTCTCCACTTCAGCCGCGACAA
ACTCTGGACGCTTAA
AA sequence
>Lus10029486 pacid=23149452 polypeptide=Lus10029486 locus=Lus10029486.g ID=Lus10029486.BGIv1.0 annot-version=v1.0
MAQPLSTSTATTPALCSSTPLLTPSLSLISWSLSMSLPFFGPSSHSIGVKICHGFSQPLLAVQITELVNGIFIGCTISYAVADGTTAGVERASSPLQPRQ
TLDA

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT2G39980 HXXXD-type acyl-transferase fa... Lus10029486 0 1
Lus10024827 2.0 0.5849
AT2G31083 AtCLE5, CLE5, C... CLAVATA3/ESR-RELATED 5 (.1) Lus10002196 20.7 0.4901
AT3G51560 Disease resistance protein (TI... Lus10029858 30.7 0.4739
AT3G54420 ATCHITIV, CHIV,... CHITINASE CLASS IV, homolog of... Lus10010863 30.9 0.4822
Lus10019558 34.3 0.4630
AT4G16195 Plant self-incompatibility pro... Lus10019768 35.8 0.4630
Lus10021773 37.3 0.4630
AT1G04520 PDLP2 plasmodesmata-located protein ... Lus10028049 38.7 0.4630
AT2G45120 C2H2ZnF C2H2-like zinc finger protein ... Lus10009278 38.8 0.4730
Lus10039552 40.1 0.4630

Lus10029486 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.