Plant FIBer expression Database

Lus10029496 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT3G57450 63 / 8e-15 unknown protein
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10019730
[exp]
66 / 6e-16 AT3G57450 66 / 8e-16 unknown protein
Lus10016391
[exp]
64 / 4e-15 AT3G57450 66 / 1e-15 unknown protein
Lus10035455
[exp]
62 / 1e-14 AT3G57450 69 / 3e-17 unknown protein
Lus10031071
[exp]
62 / 2e-14 AT3G57450 69 / 5e-17 unknown protein
Lus10018070
[exp]
56 / 6e-12 AT3G57450 66 / 1e-15 unknown protein
Lus10042063
[exp]
56 / 1e-11 AT3G57450 67 / 1e-15 unknown protein
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.001G263404
[exp]
70 / 1e-17 AT3G57450 64 / 3e-15 unknown protein
Potri.016G055901
[exp]
66 / 7e-16 AT3G57450 70 / 2e-17 unknown protein
Potri.006G050800
[exp]
57 / 1e-12 AT3G57450 59 / 4e-13 unknown protein
Potri.009G058500
[exp]
53 / 4e-11 AT3G57450 47 / 1e-08 unknown protein
Potri.012G032500
[exp]
53 / 6e-11 AT3G57450 66 / 2e-15 unknown protein
PFAM info
Representative CDS sequence
>Lus10029496 pacid=23149413 polypeptide=Lus10029496 locus=Lus10029496.g ID=Lus10029496.BGIv1.0 annot-version=v1.0
ATGGGCAAGTACATGGACATCTTGGACGCCGGCGCTCGGATTGTCGTGCGGTTTCACTCTCATTGCCCTCAGACTGCTCGGATGTACTATCACCCGCCAG
CCGCCGCCGACCAAACCCGAAACTCCTCCGCCGGAAGACGAGCTGGGTCTTGCGCGGCGTCCAAGGGGGCTAATTTTGGTAGCGACGTCAGAGAATTCGT
CTTCCATTCTTCTGTTTGA
AA sequence
>Lus10029496 pacid=23149413 polypeptide=Lus10029496 locus=Lus10029496.g ID=Lus10029496.BGIv1.0 annot-version=v1.0
MGKYMDILDAGARIVVRFHSHCPQTARMYYHPPAAADQTRNSSAGRRAGSCAASKGANFGSDVREFVFHSSV

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT3G57450 unknown protein Lus10029496
[exp]
0 1
AT4G16820 PLA-I{beta]2 phospholipase A I beta 2, alph... Lus10004364
[exp]
2.6 0.9521
AT2G46690 SAUR-like auxin-responsive pro... Lus10010110
[exp]
4.7 0.9440
AT5G61750 RmlC-like cupins superfamily p... Lus10022071
[exp]
6.0 0.9628
AT1G18740 Protein of unknown function (D... Lus10018883
[exp]
7.2 0.9322
AT5G07220 ATBAG3 BCL-2-associated athanogene 3 ... Lus10023279
[exp]
7.2 0.9612
AT3G06260 GolS9, GATL4 galactinol synthase 9, galactu... Lus10034012
[exp]
8.2 0.9583
Lus10031606
[exp]
8.3 0.9117
AT1G58070 unknown protein Lus10019953
[exp]
8.8 0.9597
AT1G05675 UDP-Glycosyltransferase superf... Lus10010468
[exp]
11.8 0.9405
AT2G47180 ATGOLS1 galactinol synthase 1 (.1) Lus10029145
[exp]
14.7 0.9450

Lus10029496 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.