Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT3G52070 62 / 2e-13 unknown protein
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10039603 [exp] 222 / 3e-76 AT3G52070 61 / 4e-13 unknown protein
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.009G059100 [exp] 125 / 2e-38 AT3G52070 67 / 2e-15 unknown protein
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10029504 pacid=23149420 polypeptide=Lus10029504 locus=Lus10029504.g ID=Lus10029504.BGIv1.0 annot-version=v1.0 ATGGCTGCTGCTCTCTCAGCTACCCTCTACATCAATCATCATCTTCATAAAAGCACCAATAACAGCTTGATTCATCAAGCCAGATGTTGTCCAAGGAGGC CTACTACAGTTGCCATTGCTTGCCATAGAGGAACAACTTCTGGAGGAACAACAACAAAGGGAAGAAAAGAGTCAAAGCAAGAGAAACAATTGTTGAGTGA GATGTTGATAGGCAGTGTGGAGAAGTTCGGGAAAGGATTGAAAGAGAGTTTGAGTCCTAAACAGAAAGGCGACTGGAAAGATGTTGTTTTGATGAGTTTG TCATTTGCAGTGTATGTCTACATGTCTCAGCAGCTTGTCTGTGCCTATTGTCTCTGGAAGTCCTTGATGAAGTAA
AA sequence Show only first row Show all	>Lus10029504 pacid=23149420 polypeptide=Lus10029504 locus=Lus10029504.g ID=Lus10029504.BGIv1.0 annot-version=v1.0 MAAALSATLYINHHLHKSTNNSLIHQARCCPRRPTTVAIACHRGTTSGGTTTKGRKESKQEKQLLSEMLIGSVEKFGKGLKESLSPKQKGDWKDVVLMSL SFAVYVYMSQQLVCAYCLWKSLMK

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT3G52070			unknown protein		Lus10029504 [exp]	0	1
AT5G06690		WCRKC1	WCRKC thioredoxin 1 (.1.2)		Lus10021067 [exp]	1.4	0.9280
AT3G52070			unknown protein		Lus10039603 [exp]	2.4	0.9120
AT3G51880		AtHMGB1, NFD1, ...	NUCLEOSOME/CHROMATIN ASSEMBLY ...		Lus10040192 [exp]	3.2	0.8908
					Lus10012544 [exp]	4.0	0.9018
AT5G23240			DNAJ heat shock N-terminal dom...		Lus10008768 [exp]	5.7	0.8935
AT3G15840		PIFI	post-illumination chlorophyll ...		Lus10038253 [exp]	6.0	0.9206
AT2G14110			Haloacid dehalogenase-like hyd...		Lus10007071 [exp]	10.3	0.8121
AT3G15850		JB67, FADB, ADS...	FATTY ACID DESATURASE B, fatty...		Lus10023128 [exp]	12.2	0.9013
AT3G55240			Plant protein 1589 of unknown ...		Lus10030322 [exp]	16.0	0.8197
AT1G74100		SOT16, ATSOT16,...	CORONATINE INDUCED-7, ARABIDOP...		Lus10033720 [exp]	18.3	0.8801

Compare expression of checked genes

Lus10029504 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.