Lus10029509 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues

No hit found

Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Poplar homologues

No hit found

PFAM info
Representative CDS sequence
>Lus10029509 pacid=23149434 polypeptide=Lus10029509 locus=Lus10029509.g ID=Lus10029509.BGIv1.0 annot-version=v1.0
ATGAGTGGATACCTAGTTAAGGATAAGCAATCTGATCAAGCGGCGGCTAGTTTTGTTGCGACTTCCTCTGCGGGAGTTGTTACATACTCTTCTTCTAAGG
CCGCTCTGGTATGCTACAAGCCGCATCCTTATGTTTTTCAGACTTGGGTCCCTGTTATACTCGGTCCAGATACTCCAGAGAAGTCTTCGGAACAATCTTC
TGCGATGCACATTGATGCCGCTCTGGCTTTGGATCCGCCTCTGTTGGATGGGCGTCTGGAATTCATGGTTGGTGCGTTGATCGCTTTGTTTTTCACTTTG
CTTTTTCCTTCGAAAATAGTGCATTTCGGGTCTCAGTTCCTTGCTTTGAAGATGACTTCCTGTCTTTTACATTGA
AA sequence
>Lus10029509 pacid=23149434 polypeptide=Lus10029509 locus=Lus10029509.g ID=Lus10029509.BGIv1.0 annot-version=v1.0
MSGYLVKDKQSDQAAASFVATSSAGVVTYSSSKAALVCYKPHPYVFQTWVPVILGPDTPEKSSEQSSAMHIDAALALDPPLLDGRLEFMVGALIALFFTL
LFPSKIVHFGSQFLALKMTSCLLH

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
Lus10029509 0 1
AT3G28857 bHLH PRE5 Paclobutrazol Resistance 5, ba... Lus10008626 1.0 0.8692
Lus10003555 1.7 0.7204
AT5G41040 HXXXD-type acyl-transferase fa... Lus10032020 2.0 0.8531
AT2G28630 KCS12 3-ketoacyl-CoA synthase 12 (.1... Lus10002190 2.4 0.6775
AT3G25280 Major facilitator superfamily ... Lus10025881 9.2 0.7101
AT3G63095 Tetratricopeptide repeat (TPR)... Lus10028014 15.9 0.5912
AT1G60170 EMB1220 embryo defective 1220, pre-mRN... Lus10027881 30.8 0.5888
AT3G19940 Major facilitator superfamily ... Lus10028729 31.3 0.6728
AT4G25810 XTH23, XTR6 xyloglucan endotransglucosylas... Lus10030484 38.0 0.6420
AT5G41040 HXXXD-type acyl-transferase fa... Lus10035189 45.7 0.6387

Lus10029509 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.