Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT3G52105 85 / 7e-24 unknown protein
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10016415 [exp] 109 / 1e-33 AT3G52105 81 / 3e-22 unknown protein Lus10019704 [exp] 109 / 2e-33 AT3G52105 80 / 6e-22 unknown protein Lus10011321 [exp] 84 / 2e-23 AT3G52105 72 / 1e-18 unknown protein Lus10042363 [exp] 83 / 7e-23 AT3G52105 75 / 6e-20 unknown protein Lus10012208 [exp] 82 / 8e-23 AT3G52105 70 / 5e-18 unknown protein Lus10026305 [exp] 82 / 5e-20 AT3G57570 229 / 2e-65 ARM repeat superfamily protein (.1.2)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.009G061800 [exp] 117 / 8e-37 AT3G52105 90 / 1e-25 unknown protein Potri.001G267501 [exp] 111 / 3e-34 AT3G52105 87 / 9e-25 unknown protein Potri.016G053400 [exp] 89 / 4e-25 AT3G52105 76 / 9e-20 unknown protein Potri.006G054200 [exp] 82 / 9e-23 AT3G52105 67 / 2e-16 unknown protein
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10029521 pacid=23149421 polypeptide=Lus10029521 locus=Lus10029521.g ID=Lus10029521.BGIv1.0 annot-version=v1.0 ATGGCTCTGCAGCTTTTCTTCACGATAGCCTTCTCGGCGGTGCCCTTGACTCTGTATATTCCGCCTGTGAGGAGCTTGAATCTGTTCGTAGAGACCATGG AGGATCTGGTCAGAGAATCTAGGGTTTATACTGTTAGGTACTATCCTCGCGCCAGGAACGTCTGGTCAAGGCTCTGGAATGTTCTCCTCTGCAACTTTAG GTTACGCTAA
AA sequence Show only first row Show all	>Lus10029521 pacid=23149421 polypeptide=Lus10029521 locus=Lus10029521.g ID=Lus10029521.BGIv1.0 annot-version=v1.0 MALQLFFTIAFSAVPLTLYIPPVRSLNLFVETMEDLVRESRVYTVRYYPRARNVWSRLWNVLLCNFRLR

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT3G52105			unknown protein		Lus10029521 [exp]	0	1
AT2G46940			unknown protein		Lus10038023 [exp]	1.4	0.8476
AT4G39040			RNA-binding CRS1 / YhbY (CRM) ...		Lus10028787 [exp]	13.1	0.8224
AT2G21600		ATRER1B	endoplasmatic reticulum retrie...		Lus10041766 [exp]	21.7	0.8133
AT1G75180			Erythronate-4-phosphate dehydr...		Lus10016311 [exp]	26.3	0.7167
AT3G06590	bHLH	bHLH148, AIF2	basic helix-loop-helix (bHLH) ...		Lus10010907 [exp]	37.8	0.8124
AT2G17880			Chaperone DnaJ-domain superfam...		Lus10028453 [exp]	41.1	0.8139
AT4G36040		J11	DnaJ11, Chaperone DnaJ-domain ...		Lus10041906 [exp]	54.1	0.7919
AT5G17540			HXXXD-type acyl-transferase fa...		Lus10005659 [exp]	57.8	0.8035
AT4G25030			unknown protein		Lus10033276 [exp]	66.1	0.7538
AT3G50980		XERO1	dehydrin xero 1 (.1)		Lus10014280 [exp]	68.5	0.7862

Compare expression of checked genes

Lus10029521 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.