Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT5G23530 97 / 5e-26 ATCXE18 carboxyesterase 18 (.1) AT5G27320 42 / 5e-06 ATGID1C, GID1C GA INSENSITIVE DWARF1C, alpha/beta-Hydrolases superfamily protein (.1) AT3G05120 39 / 5e-05 ATGID1A, GID1A GA INSENSITIVE DWARF1A, alpha/beta-Hydrolases superfamily protein (.1) AT3G63010 37 / 0.0004 ATGID1B, GID1B GA INSENSITIVE DWARF1B, alpha/beta-Hydrolases superfamily protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10039621 [exp] 135 / 1e-43 AT5G23530 97 / 5e-26 carboxyesterase 18 (.1) Lus10013771 [exp] 84 / 6e-23 AT5G23530 96 / 4e-25 carboxyesterase 18 (.1) Lus10039162 [exp] 87 / 5e-22 AT5G23530 324 / 3e-110 carboxyesterase 18 (.1) Lus10013774 [exp] 69 / 1e-15 AT5G23530 315 / 2e-106 carboxyesterase 18 (.1) Lus10002254 [exp] 40 / 4e-05 AT5G27320 550 / 0.0 GA INSENSITIVE DWARF1C, alpha/beta-Hydrolases superfamily protein (.1) Lus10000928 [exp] 39 / 5e-05 AT5G27320 553 / 0.0 GA INSENSITIVE DWARF1C, alpha/beta-Hydrolases superfamily protein (.1) Lus10008189 [exp] 35 / 0.0007 AT3G63010 206 / 4e-67 GA INSENSITIVE DWARF1B, alpha/beta-Hydrolases superfamily protein (.1) Lus10027969 [exp] 36 / 0.001 AT3G63010 566 / 0.0 GA INSENSITIVE DWARF1B, alpha/beta-Hydrolases superfamily protein (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.004G092500 [exp] 106 / 2e-29 AT5G23530 388 / 3e-135 carboxyesterase 18 (.1) Potri.019G014306 [exp] 79 / 1e-19 AT5G23530 0 / 1 carboxyesterase 18 (.1) Potri.019G014302 [exp] 78 / 5e-19 AT5G23530 329 / 3e-112 carboxyesterase 18 (.1) Potri.001G459400 [exp] 75 / 7e-18 AT5G23530 327 / 1e-111 carboxyesterase 18 (.1) Potri.006G198800 [exp] 39 / 6e-05 AT5G06570 373 / 1e-129 alpha/beta-Hydrolases superfamily protein (.1.2) Potri.013G028700 [exp] 39 / 7e-05 AT5G27320 608 / 0.0 GA INSENSITIVE DWARF1C, alpha/beta-Hydrolases superfamily protein (.1) Potri.002G213100 [exp] 37 / 0.0004 AT3G63010 578 / 0.0 GA INSENSITIVE DWARF1B, alpha/beta-Hydrolases superfamily protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0028 [flax] [poplar] AB_hydrolase PF07859 [flax] [poplar] Abhydrolase_3 alpha/beta hydrolase fold
Representative CDS sequence Show only first row Show all	>Lus10029542 pacid=23149353 polypeptide=Lus10029542 locus=Lus10029542.g ID=Lus10029542.BGIv1.0 annot-version=v1.0 ATGGTGATCGTGGGTGGATTGGACCCGCTACAGGACTGGCAGAGGAAGTATTACAAATGGCTCAAGAGAATGGAGAAGGAGGCGACGATGATCGAGTACC CGAATATGATCCATGCGTTTTACATGTTCCCTGAACTGCCGGAATCGGCCGAGGTTTTCGCTCAGGTGAGGGATTTCGTTGCCAGGAAGTCGGCCTCCTG A
AA sequence Show only first row Show all	>Lus10029542 pacid=23149353 polypeptide=Lus10029542 locus=Lus10029542.g ID=Lus10029542.BGIv1.0 annot-version=v1.0 MVIVGGLDPLQDWQRKYYKWLKRMEKEATMIEYPNMIHAFYMFPELPESAEVFAQVRDFVARKSAS

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT5G23530		ATCXE18	carboxyesterase 18 (.1)		Lus10029542 [exp]	0	1
AT3G48690		ATCXE12	ARABIDOPSIS THALIANA CARBOXYES...		Lus10027909 [exp]	13.8	0.7663
AT2G25490		FBL6, EBF1	EIN3-binding F box protein 1 (...		Lus10002165 [exp]	15.6	0.7510
AT5G48490			Bifunctional inhibitor/lipid-t...		Lus10002741 [exp]	16.5	0.7236
AT1G76920			F-box family protein (.1)		Lus10018896 [exp]	17.8	0.7615
AT3G12630		SAP5	stress associated protein 5, A...		Lus10037702 [exp]	23.0	0.7448
AT5G19790	AP2_ERF	RAP2.11	related to AP2 11 (.1)		Lus10036556 [exp]	30.6	0.7394
AT2G38360		PRA1.B4	prenylated RAB acceptor 1.B4 (...		Lus10002853 [exp]	31.5	0.7423
AT1G18480		AtSLP2	Shewenella-like protein phosph...		Lus10038865 [exp]	34.5	0.7324
AT4G24370			unknown protein		Lus10010164 [exp]	35.9	0.7171
AT2G25620		AtDBP1	DNA-binding protein phosphatas...		Lus10030115 [exp]	39.6	0.7356

Compare expression of checked genes

Lus10029542 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.