Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT2G02130 59 / 5e-13 PDF2.3, LCR68 low-molecular-weight cysteine-rich 68 (.1) AT5G63660 57 / 2e-12 LCR74, PDF2.5 LOW-MOLECULAR-WEIGHT CYSTEINE-RICH 74, Scorpion toxin-like knottin superfamily protein (.1) AT1G61070 53 / 1e-10 LCR66, PDF2.4 PLANT DEFENSIN 2.4, low-molecular-weight cysteine-rich 66 (.1) AT2G02100 51 / 4e-10 LCR69, PDF2.2 low-molecular-weight cysteine-rich 69 (.1) AT2G02120 50 / 9e-10 PDF2.1, LCR70 LOW-MOLECULAR-WEIGHT CYSTEINE-RICH 70, Scorpion toxin-like knottin superfamily protein (.1) AT2G02147 37 / 9e-05 LCR73 low-molecular-weight cysteine-rich 73 (.1) AT2G02140 35 / 0.0006 LCR72, PDF2.6 low-molecular-weight cysteine-rich 72 (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10019226 [exp] 61 / 5e-14 AT2G02120 81 / 6e-22 LOW-MOLECULAR-WEIGHT CYSTEINE-RICH 70, Scorpion toxin-like knottin superfamily protein (.1) Lus10004290 [exp] 58 / 1e-12 AT2G02130 78 / 1e-20 low-molecular-weight cysteine-rich 68 (.1) Lus10019227 [exp] 58 / 3e-12 AT2G02130 66 / 1e-15 low-molecular-weight cysteine-rich 68 (.1) Lus10004289 [exp] 57 / 3e-12 AT2G02130 78 / 1e-20 low-molecular-weight cysteine-rich 68 (.1) Lus10029546 [exp] 35 / 0.0006 AT2G02120 65 / 1e-15 LOW-MOLECULAR-WEIGHT CYSTEINE-RICH 70, Scorpion toxin-like knottin superfamily protein (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.T011301 [exp] 73 / 1e-18 AT5G63660 62 / 2e-14 LOW-MOLECULAR-WEIGHT CYSTEINE-RICH 74, Scorpion toxin-like knottin superfamily protein (.1) Potri.T011300 [exp] 73 / 1e-18 AT5G63660 62 / 2e-14 LOW-MOLECULAR-WEIGHT CYSTEINE-RICH 74, Scorpion toxin-like knottin superfamily protein (.1) Potri.004G138100 [exp] 58 / 6e-13 AT5G63660 71 / 4e-18 LOW-MOLECULAR-WEIGHT CYSTEINE-RICH 74, Scorpion toxin-like knottin superfamily protein (.1) Potri.T011201 [exp] 54 / 2e-11 AT2G02130 76 / 6e-20 low-molecular-weight cysteine-rich 68 (.1) Potri.T011200 [exp] 54 / 2e-11 AT2G02130 76 / 6e-20 low-molecular-weight cysteine-rich 68 (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0054 [flax] [poplar] Knottin_1 PF00304 [flax] [poplar] Gamma-thionin Gamma-thionin family
Representative CDS sequence Show only first row Show all	>Lus10029544 pacid=23149393 polypeptide=Lus10029544 locus=Lus10029544.g ID=Lus10029544.BGIv1.0 annot-version=v1.0 ATGGCGAAGCTGCACTACAGCGTTCCCCGTTTCTTCCTTGTGCTGATGCTCCTCATTTTCATGGCTTCCACCTATGAAAAGATGGGGATGGTGAAAGTGG CAGAGGCGAGGGTGTGTGCCTCACAGAGCCATTACTTCAAAGGTCCCTGCGGCAGAGATCACAACTGCGCTATGGTCTGCCGCAATGAGGGGTTATCCGG CGGCCGCTGCAAGGGTTTCCGTCGCCGCTGTTTCTGCACCAGGCTCTGCTAA
AA sequence Show only first row Show all	>Lus10029544 pacid=23149393 polypeptide=Lus10029544 locus=Lus10029544.g ID=Lus10029544.BGIv1.0 annot-version=v1.0 MAKLHYSVPRFFLVLMLLIFMASTYEKMGMVKVAEARVCASQSHYFKGPCGRDHNCAMVCRNEGLSGGRCKGFRRRCFCTRLC

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT2G02130		PDF2.3, LCR68	low-molecular-weight cysteine-...		Lus10029544 [exp]	0	1
AT5G26650	MADS	AGL36	AGAMOUS-like 36 (.1)		Lus10007592 [exp]	1.4	0.8903
AT4G15620			Uncharacterised protein family...		Lus10012562 [exp]	1.7	0.8999
AT1G05205			unknown protein		Lus10027173 [exp]	6.9	0.8657
AT5G01870			Bifunctional inhibitor/lipid-t...		Lus10025148 [exp]	7.5	0.8828
					Lus10026443 [exp]	9.4	0.8569
AT5G20510	Alfin	AL5	alfin-like 5 (.1)		Lus10015637 [exp]	14.0	0.8484
AT1G17140		RIP1, ICR1	ROP INTERACTIVE PARTNER 1, int...		Lus10013708 [exp]	14.1	0.8653
AT5G55590		QRT1	QUARTET 1, Pectin lyase-like s...		Lus10016605 [exp]	14.7	0.8354
AT3G45740			hydrolase family protein / HAD...		Lus10001969 [exp]	17.1	0.7326
AT3G45740			hydrolase family protein / HAD...		Lus10008416 [exp]	19.2	0.7620

Compare expression of checked genes

Lus10029544 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.