Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	No hit found
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10002236 [exp] 117 / 3e-36 AT5G25940 82 / 3e-21 early nodulin-related (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.019G033700 [exp] 48 / 9e-09 AT5G25940 68 / 1e-15 early nodulin-related (.1)
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10029566 pacid=23152161 polypeptide=Lus10029566 locus=Lus10029566.g ID=Lus10029566.BGIv1.0 annot-version=v1.0 ATGGGGATTCCGTCTGACATGCGAGACTATTGGGCACAATCCATCGGAAGCAAGCGAAGCAGCTCCTTCATGATTGCTTCTCCAGACGAGAAACGCAACA AAGCTTTTGCTCAAGACAGCGTCATTGCTGGATTCAAAGCAGCTGTAGTCGCGGCGGTTCTCACCACTGGTCCTGTGGTAGGTTGA
AA sequence Show only first row Show all	>Lus10029566 pacid=23152161 polypeptide=Lus10029566 locus=Lus10029566.g ID=Lus10029566.BGIv1.0 annot-version=v1.0 MGIPSDMRDYWAQSIGSKRSSSFMIASPDEKRNKAFAQDSVIAGFKAAVVAAVLTTGPVVG

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
					Lus10029566 [exp]	0	1
AT5G04390	C2H2ZnF		C2H2-type zinc finger family p...		Lus10037942 [exp]	15.4	0.7641
AT1G47960		ATC/VIF1, C/VIF...	cell wall / vacuolar inhibitor...		Lus10017014 [exp]	21.7	0.8178
AT5G54740		SESA5	seed storage albumin 5 (.1)		Lus10023514 [exp]	29.3	0.8021
AT1G03220			Eukaryotic aspartyl protease f...		Lus10034036 [exp]	63.5	0.7862
AT3G62890			Pentatricopeptide repeat (PPR)...		Lus10033544 [exp]	65.2	0.7761
AT5G19890			Peroxidase superfamily protein...		Lus10026748 [exp]	66.8	0.7906
					Lus10031595 [exp]	68.2	0.7347
AT1G29880			glycyl-tRNA synthetase / glyci...		Lus10036930 [exp]	76.7	0.7740
AT1G66980		GDPDL2, SNC4	Glycerophosphodiester phosphod...		Lus10040037 [exp]	88.3	0.7723
					Lus10028245 [exp]	89.5	0.7291

Compare expression of checked genes

Lus10029566 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.