Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT3G05950 171 / 1e-54 RmlC-like cupins superfamily protein (.1) AT5G39150 167 / 2e-53 RmlC-like cupins superfamily protein (.1) AT5G39120 167 / 2e-53 RmlC-like cupins superfamily protein (.1) AT5G39110 167 / 2e-53 RmlC-like cupins superfamily protein (.1) AT5G39180 166 / 9e-53 RmlC-like cupins superfamily protein (.1) AT5G39190 164 / 4e-52 ATGER2, GLP2A GERMIN-LIKE PROTEIN 2A, A. THALIANA GERMIN LIKE PROTEIN 2, germin-like protein 2 (.1.2) AT5G39160 163 / 4e-52 RmlC-like cupins superfamily protein (.1.2.3) AT5G39130 163 / 1e-51 RmlC-like cupins superfamily protein (.1) AT5G38960 162 / 2e-51 RmlC-like cupins superfamily protein (.1) AT5G38940 162 / 2e-51 RmlC-like cupins superfamily protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10035280 [exp] 218 / 3e-73 AT3G05950 252 / 2e-85 RmlC-like cupins superfamily protein (.1) Lus10035185 [exp] 217 / 5e-73 AT5G39160 265 / 2e-90 RmlC-like cupins superfamily protein (.1.2.3) Lus10035186 [exp] 217 / 5e-73 AT5G39190 265 / 2e-90 GERMIN-LIKE PROTEIN 2A, A. THALIANA GERMIN LIKE PROTEIN 2, germin-like protein 2 (.1.2) Lus10032016 [exp] 216 / 1e-72 AT5G39160 264 / 3e-90 RmlC-like cupins superfamily protein (.1.2.3) Lus10032017 [exp] 218 / 2e-72 AT3G05950 252 / 5e-84 RmlC-like cupins superfamily protein (.1) Lus10026962 [exp] 216 / 2e-72 AT3G05950 251 / 6e-85 RmlC-like cupins superfamily protein (.1) Lus10030048 [exp] 215 / 4e-72 AT3G05950 249 / 3e-84 RmlC-like cupins superfamily protein (.1) Lus10030047 [exp] 214 / 5e-72 AT3G05950 256 / 7e-87 RmlC-like cupins superfamily protein (.1) Lus10029010 [exp] 214 / 1e-71 AT3G05950 250 / 2e-84 RmlC-like cupins superfamily protein (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.011G162932 [exp] 209 / 9e-70 AT3G05950 268 / 1e-91 RmlC-like cupins superfamily protein (.1) Potri.011G163200 [exp] 208 / 1e-69 AT3G05950 266 / 5e-91 RmlC-like cupins superfamily protein (.1) Potri.011G163800 [exp] 203 / 2e-67 AT5G39130 255 / 1e-86 RmlC-like cupins superfamily protein (.1) Potri.011G163300 [exp] 200 / 2e-66 AT5G39160 257 / 2e-87 RmlC-like cupins superfamily protein (.1.2.3) Potri.011G163216 [exp] 200 / 2e-66 AT5G39160 257 / 2e-87 RmlC-like cupins superfamily protein (.1.2.3) Potri.001G465100 [exp] 192 / 2e-63 AT5G39160 253 / 8e-86 RmlC-like cupins superfamily protein (.1.2.3) Potri.013G052300 [exp] 189 / 2e-61 AT5G39110 281 / 2e-96 RmlC-like cupins superfamily protein (.1) Potri.013G052000 [exp] 188 / 2e-61 AT5G39110 282 / 5e-97 RmlC-like cupins superfamily protein (.1) Potri.013G052100 [exp] 188 / 2e-61 AT5G39110 285 / 2e-98 RmlC-like cupins superfamily protein (.1) Potri.011G162200 [exp] 181 / 7e-59 AT5G39190 246 / 4e-83 GERMIN-LIKE PROTEIN 2A, A. THALIANA GERMIN LIKE PROTEIN 2, germin-like protein 2 (.1.2)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0029 [flax] [poplar] Cupin PF00190 [flax] [poplar] Cupin_1 Cupin
Representative CDS sequence Show only first row Show all	>Lus10029571 pacid=23152127 polypeptide=Lus10029571 locus=Lus10029571.g ID=Lus10029571.BGIv1.0 annot-version=v1.0 ATGGTGGCTCAGATTCCAGGCCTCAGCACGTTGGGAATCCCTTTGGTTCGCATTGATTATGCTCCACGGGGCATTAACCCACCCCACACACATCCTCGTG TCACTGAGATTCTCACAGTTGTCGAAGGGACGTTGGAGGTTGGATTCGTTACTTCGAACCCTGAGAACCGTTTGATATCCAAGATCCTCCAGAAAGACGA TGTGTTTGTCTTTCCGATTGGGTTGCTCCACTACCAACATAGTGTTGGGAATGAAAATGCGATGGCCATTGCTGGATTGAGTAGTCAAAATCCTGAAGTT ATCACTATTGTCAACTCTGTTTTCGGTTCCAAGCCGGACATCTCCGGTGACATCCTTGCTAACGCTTTTCAAGTTGATAAATATGTTGCAGAGCAGACTA TTTATGCTTTTTAA
AA sequence Show only first row Show all	>Lus10029571 pacid=23152127 polypeptide=Lus10029571 locus=Lus10029571.g ID=Lus10029571.BGIv1.0 annot-version=v1.0 MVAQIPGLSTLGIPLVRIDYAPRGINPPHTHPRVTEILTVVEGTLEVGFVTSNPENRLISKILQKDDVFVFPIGLLHYQHSVGNENAMAIAGLSSQNPEV ITIVNSVFGSKPDISGDILANAFQVDKYVAEQTIYAF

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT3G05950			RmlC-like cupins superfamily p...		Lus10029571 [exp]	0	1
AT4G24890		ATPAP24, PAP24	ARABIDOPSIS THALIANA PURPLE AC...		Lus10016356 [exp]	5.9	0.8828
AT5G50400		ATPAP27, PAP27	ARABIDOPSIS THALIANA PURPLE AC...		Lus10019771 [exp]	9.6	0.8777
AT5G46420			16S rRNA processing protein Ri...		Lus10011969 [exp]	16.0	0.8561
AT1G45474		LHCA5	photosystem I light harvesting...		Lus10042657 [exp]	22.2	0.8733
AT3G16250		PnsB3, NDF4	Photosynthetic NDH subcomplex...		Lus10025809 [exp]	26.3	0.8644
AT2G01918		PQL3	PsbQ-like 3 (.1)		Lus10002286 [exp]	28.1	0.8600
AT4G19180			GDA1/CD39 nucleoside phosphata...		Lus10039953 [exp]	28.7	0.7814
AT5G19220		ADG2, APL1	ADP GLUCOSE PYROPHOSPHORYLASE ...		Lus10010515 [exp]	32.4	0.8597
AT5G53850			haloacid dehalogenase-like hyd...		Lus10005542 [exp]	42.0	0.8549
AT1G08540		ATSIG1, SIG1, S...	SIGMA FACTOR B, RNA POLYMERASE...		Lus10013642 [exp]	45.4	0.8587

Compare expression of checked genes

Lus10029571 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.