Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT2G28670 166 / 5e-53 ESB1 ENHANCED SUBERIN 1, Disease resistance-responsive (dirigent-like protein) family protein (.1), Disease resistance-responsive (dirigent-like protein) family protein (.2) AT1G07730 167 / 1e-51 Disease resistance-responsive (dirigent-like protein) family protein (.2) AT2G39430 137 / 1e-40 Disease resistance-responsive (dirigent-like protein) family protein (.1) AT3G24020 130 / 8e-39 Disease resistance-responsive (dirigent-like protein) family protein (.1) AT4G13580 125 / 7e-37 Disease resistance-responsive (dirigent-like protein) family protein (.1) AT3G55230 121 / 1e-34 Disease resistance-responsive (dirigent-like protein) family protein (.1) AT2G21100 62 / 1e-12 Disease resistance-responsive (dirigent-like protein) family protein (.1) AT1G65870 61 / 3e-12 Disease resistance-responsive (dirigent-like protein) family protein (.1) AT1G22900 60 / 4e-12 Disease resistance-responsive (dirigent-like protein) family protein (.1) AT5G42500 58 / 2e-11 Disease resistance-responsive (dirigent-like protein) family protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10006317 [exp] 246 / 1e-83 AT2G28670 271 / 1e-89 ENHANCED SUBERIN 1, Disease resistance-responsive (dirigent-like protein) family protein (.1), Disease resistance-responsive (dirigent-like protein) family protein (.2) Lus10011767 [exp] 125 / 1e-36 AT3G24020 339 / 7e-119 Disease resistance-responsive (dirigent-like protein) family protein (.1) Lus10023689 [exp] 125 / 2e-36 AT3G24020 336 / 1e-117 Disease resistance-responsive (dirigent-like protein) family protein (.1) Lus10030318 [exp] 118 / 8e-34 AT3G55230 276 / 2e-93 Disease resistance-responsive (dirigent-like protein) family protein (.1) Lus10003301 [exp] 115 / 7e-31 AT3G55230 254 / 2e-80 Disease resistance-responsive (dirigent-like protein) family protein (.1) Lus10034479 [exp] 70 / 9e-16 AT2G21100 189 / 9e-62 Disease resistance-responsive (dirigent-like protein) family protein (.1) Lus10025064 [exp] 67 / 7e-15 AT2G21100 197 / 9e-65 Disease resistance-responsive (dirigent-like protein) family protein (.1) Lus10025063 [exp] 63 / 9e-13 AT2G21100 183 / 4e-58 Disease resistance-responsive (dirigent-like protein) family protein (.1) Lus10021084 [exp] 62 / 1e-12 AT5G42500 164 / 2e-51 Disease resistance-responsive (dirigent-like protein) family protein (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.010G211800 [exp] 183 / 8e-59 AT2G28670 257 / 6e-83 ENHANCED SUBERIN 1, Disease resistance-responsive (dirigent-like protein) family protein (.1), Disease resistance-responsive (dirigent-like protein) family protein (.2) Potri.008G049200 [exp] 182 / 2e-58 AT2G28670 276 / 2e-90 ENHANCED SUBERIN 1, Disease resistance-responsive (dirigent-like protein) family protein (.1), Disease resistance-responsive (dirigent-like protein) family protein (.2) Potri.008G049100 [exp] 145 / 6e-43 AT2G39430 251 / 6e-81 Disease resistance-responsive (dirigent-like protein) family protein (.1) Potri.010G211900 [exp] 142 / 7e-42 AT2G39430 249 / 3e-80 Disease resistance-responsive (dirigent-like protein) family protein (.1) Potri.001G054100 [exp] 137 / 6e-41 AT4G13580 308 / 3e-106 Disease resistance-responsive (dirigent-like protein) family protein (.1) Potri.003G174300 [exp] 129 / 2e-38 AT3G24020 315 / 2e-109 Disease resistance-responsive (dirigent-like protein) family protein (.1) Potri.001G054000 [exp] 125 / 1e-36 AT3G24020 352 / 5e-124 Disease resistance-responsive (dirigent-like protein) family protein (.1) Potri.010G212000 [exp] 91 / 2e-23 AT1G07730 103 / 1e-25 Disease resistance-responsive (dirigent-like protein) family protein (.2) Potri.003G134800 [exp] 62 / 8e-13 AT1G64160 188 / 4e-61 Disease resistance-responsive (dirigent-like protein) family protein (.1) Potri.008G061400 [exp] 61 / 1e-12 AT2G21110 223 / 7e-75 Disease resistance-responsive (dirigent-like protein) family protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0650 [flax] [poplar] AOC_barrel PF03018 [flax] [poplar] Dirigent Dirigent-like protein
Representative CDS sequence Show only first row Show all	>Lus10029585 pacid=23152130 polypeptide=Lus10029585 locus=Lus10029585.g ID=Lus10029585.BGIv1.0 annot-version=v1.0 ATGTTCGGGACAATAACAGTGATCGACGATGAGCTCACGGAAGGGCATGAATTGGGGTCTCCTCTTGTGGGGAAAGCACAAGGGTACTACGTGGCCAGTT CGATTGATGGGAATAGTCAGGCCATGGCGTTTACGGCCATGTTCCATAGCGGTCACTATGAAGATAGTCTAAACTTCTTCGGAGTTCATAGGGCCGGTGT GTCGGAATCTCAGCTTGCTGTAATGGGCGGGACGGGGAAGTATGTGAATGCTAAGGGACATGCTGTGGTGAAGACCATCCTTCCTGGTGCAGGTGGAATT GGAAACCAGCATGAAACTGATGGGTTTGAGACTTTGCTGGAGTTTACTGTTTATGTTGCATACTGA
AA sequence Show only first row Show all	>Lus10029585 pacid=23152130 polypeptide=Lus10029585 locus=Lus10029585.g ID=Lus10029585.BGIv1.0 annot-version=v1.0 MFGTITVIDDELTEGHELGSPLVGKAQGYYVASSIDGNSQAMAFTAMFHSGHYEDSLNFFGVHRAGVSESQLAVMGGTGKYVNAKGHAVVKTILPGAGGI GNQHETDGFETLLEFTVYVAY

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT2G28670		ESB1	ENHANCED SUBERIN 1, Disease re...		Lus10029585 [exp]	0	1
AT2G28670		ESB1	ENHANCED SUBERIN 1, Disease re...		Lus10006317 [exp]	1.0	0.9848
AT3G55230			Disease resistance-responsive ...		Lus10030318 [exp]	1.4	0.9840
AT1G03220			Eukaryotic aspartyl protease f...		Lus10021936 [exp]	2.8	0.9515
AT3G11660		NHL1	NDR1/HIN1-like 1 (.1)		Lus10029406 [exp]	3.2	0.9562
AT3G51770		ATEOL1, ETO1	ARABIDOPSIS ETHYLENE OVERPRODU...		Lus10031859 [exp]	3.3	0.9482
AT1G22360		ATUGT85A2, AT2	UDP-glucosyl transferase 85A2 ...		Lus10041055 [exp]	4.0	0.9563
AT3G04830			Protein prenylyltransferase su...		Lus10001785 [exp]	4.6	0.9410
AT3G15730		PLDALPHA1	phospholipase D alpha 1 (.1)		Lus10018575 [exp]	4.6	0.9627
AT3G26590			MATE efflux family protein (.1...		Lus10036854 [exp]	5.1	0.9460
AT3G56230			BTB/POZ domain-containing prot...		Lus10010216 [exp]	5.3	0.9525

Compare expression of checked genes

Lus10029585 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.