Lus10029598 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT5G52060 195 / 7e-61 ATBAG1 BCL-2-associated athanogene 1 (.1)
AT5G62100 189 / 3e-59 ATBAG2 BCL-2-associated athanogene 2 (.1.2.3)
AT5G07220 175 / 1e-53 ATBAG3 BCL-2-associated athanogene 3 (.1)
AT3G51780 133 / 1e-37 ATBAG4 BCL-2-associated athanogene 4 (.1)
AT5G14360 72 / 1e-15 Ubiquitin-like superfamily protein (.1)
AT5G40630 68 / 6e-14 Ubiquitin-like superfamily protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10006328 442 / 2e-159 AT5G52060 194 / 2e-60 BCL-2-associated athanogene 1 (.1)
Lus10038882 206 / 1e-65 AT5G52060 327 / 1e-111 BCL-2-associated athanogene 1 (.1)
Lus10015004 199 / 1e-62 AT5G52060 333 / 4e-114 BCL-2-associated athanogene 1 (.1)
Lus10027420 197 / 1e-61 AT5G52060 349 / 6e-120 BCL-2-associated athanogene 1 (.1)
Lus10005772 155 / 8e-46 AT5G52060 304 / 2e-102 BCL-2-associated athanogene 1 (.1)
Lus10023279 148 / 6e-44 AT5G07220 196 / 4e-62 BCL-2-associated athanogene 3 (.1)
Lus10005051 123 / 1e-32 AT3G51780 221 / 1e-69 BCL-2-associated athanogene 4 (.1)
Lus10027822 118 / 2e-31 AT3G51780 221 / 4e-71 BCL-2-associated athanogene 4 (.1)
Lus10003393 89 / 6e-21 AT3G51780 180 / 5e-56 BCL-2-associated athanogene 4 (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.003G121500 242 / 7e-80 AT5G52060 243 / 1e-78 BCL-2-associated athanogene 1 (.1)
Potri.001G110300 241 / 2e-78 AT5G52060 239 / 2e-76 BCL-2-associated athanogene 1 (.1)
Potri.012G133400 218 / 2e-69 AT5G52060 305 / 2e-102 BCL-2-associated athanogene 1 (.1)
Potri.015G135500 213 / 2e-67 AT5G52060 303 / 2e-101 BCL-2-associated athanogene 1 (.1)
Potri.001G279500 145 / 1e-42 AT3G51780 210 / 2e-67 BCL-2-associated athanogene 4 (.1)
Potri.009G074300 145 / 3e-42 AT3G51780 196 / 4e-62 BCL-2-associated athanogene 4 (.1)
Potri.001G358200 142 / 2e-41 AT5G07220 207 / 9e-66 BCL-2-associated athanogene 3 (.1)
Potri.001G339100 77 / 3e-17 AT5G14360 166 / 6e-53 Ubiquitin-like superfamily protein (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
PF02179 BAG BAG domain
Representative CDS sequence
>Lus10029598 pacid=23151983 polypeptide=Lus10029598 locus=Lus10029598.g ID=Lus10029598.BGIv1.0 annot-version=v1.0
ATGGAGGAGGCAATCAAGTCAATGATGAGAGTTGAAGAATTGGAAATCAGACCAGGAGGAATGTTGGTACAGAAGAGGGATTCTTCTGAATCCAGAAATC
ACAGTTACAGCAACAATTCAATTGTTGTTCCTATGATCAGAGTCAAGGTCAAATTTGGATCTTCGTATCACAATGTTTCCATCAGTTCTCAAGCTAGCTT
TGGGGAACTGAAGAAAATGCTGGCAGAATCAACAGGAGTTCACCATCAGGACCAGAAGCTGATGTACAAGAAGAAAGAGAAGGATTCCAGGATGTTTTTG
GACATTGAAAGAGTGAAAGATGGATCCAAACTTGTTCTAATCGAGGACATCAGCAGAAGCGGAAGGCGGCTTCTTGAGCTGATCAAGACCTCCGGGCTAC
AGAAGGTTTTGAAATCCATTGAGCAAATAACCAAAGAAGTTGATACACTTGCTCACAAGGTGACATCCTTGGAAGCAACAAGTTCTCGAGGAGGGATAGT
AGCGGAGATTGACATTGATGATCTAACAGAATCGTCAATGTCAAAACTTGTGGAGCTAGATAGGATTCTGGTAGTGGATGGAACCTTAAAGTTGCAGAAG
ACAACTCAGGAAAGGCGGCTTCAGAAGTGCATAGAGAGTCTTGATAAGCTGAAGTCAGAGACTTGTTCTGGCAATCACAACAGCAAAATGAAGCAAAGGC
AAAAGCTTTCTGAAGCAGCTGCGGTCACCACCACAACCAAATGGGAAATCTTTGATTGA
AA sequence
>Lus10029598 pacid=23151983 polypeptide=Lus10029598 locus=Lus10029598.g ID=Lus10029598.BGIv1.0 annot-version=v1.0
MEEAIKSMMRVEELEIRPGGMLVQKRDSSESRNHSYSNNSIVVPMIRVKVKFGSSYHNVSISSQASFGELKKMLAESTGVHHQDQKLMYKKKEKDSRMFL
DIERVKDGSKLVLIEDISRSGRRLLELIKTSGLQKVLKSIEQITKEVDTLAHKVTSLEATSSRGGIVAEIDIDDLTESSMSKLVELDRILVVDGTLKLQK
TTQERRLQKCIESLDKLKSETCSGNHNSKMKQRQKLSEAAAVTTTTKWEIFD

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT5G52060 ATBAG1 BCL-2-associated athanogene 1 ... Lus10029598 0 1
AT5G52060 ATBAG1 BCL-2-associated athanogene 1 ... Lus10006328 7.5 0.7253
Lus10021499 12.6 0.7442
AT3G23730 XTH16 xyloglucan endotransglucosylas... Lus10008522 16.5 0.6833
AT1G76200 unknown protein Lus10016001 26.0 0.7408
AT2G38710 AMMECR1 family (.1.2) Lus10029751 33.4 0.6905
AT1G69510 cAMP-regulated phosphoprotein ... Lus10030448 34.2 0.6986
AT2G38710 AMMECR1 family (.1.2) Lus10042783 34.3 0.7002
AT2G38710 AMMECR1 family (.1.2) Lus10029750 35.8 0.6911
AT2G38310 RCAR10, PYL4 regulatory components of ABA r... Lus10012231 50.4 0.6520
AT5G10770 Eukaryotic aspartyl protease f... Lus10042426 53.6 0.6661

Lus10029598 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.