Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	No hit found
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10019772 [exp] 129 / 9e-36 AT5G50400 287 / 2e-84 ARABIDOPSIS THALIANA PURPLE ACID PHOSPHATASE 27, purple acid phosphatase 27 (.1) Lus10013548 [exp] 112 / 8e-31 AT5G06600 55 / 3e-08 ubiquitin-specific protease 12 (.1.2.3) Lus10008233 [exp] 109 / 2e-29 ND / Lus10017290 [exp] 103 / 7e-28 ND / Lus10025569 [exp] 105 / 9e-28 AT5G06600 149 / 7e-39 ubiquitin-specific protease 12 (.1.2.3) Lus10023536 [exp] 91 / 7e-25 ND / Lus10012947 [exp] 87 / 4e-23 ND / Lus10017291 [exp] 88 / 2e-21 AT5G06600 100 / 3e-22 ubiquitin-specific protease 12 (.1.2.3) Lus10040421 [exp] 75 / 7e-18 ND /
Poplar homologues Show only best Show top 10	No hit found
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10029608 pacid=23152083 polypeptide=Lus10029608 locus=Lus10029608.g ID=Lus10029608.BGIv1.0 annot-version=v1.0 ATGGAAGACCTTATCTCGAGCCTGGCAGTGTTTAAGGAGACTGTTCCTCTCTCACTGTCAACTTTCGAAACTTGCCTTGTTATTGAAACATCTAAAGGTC AGATGACTAAGGATTTGGAGGAGAGGTTGGCTAACAGGAAGGAGCAACTGACAACATTGGACGCAGAGGTTTTTAAACTTGGGGAAGAAGGCTCGAAGCT GGATGTCGAAATTCAGCAATCAACTGATCGAAGGGCTGCAATTCTTGAACGAGTGGATTCTACCGAGGTAGAACTGGAGAAGGCCAACCAAGAGGCTTCT AAGGAACTGGATGAACTGAAGAAGGAAAATGACGAGCTGAAGCAAGCAGTGGAAAAGCGGATGTGA
AA sequence Show only first row Show all	>Lus10029608 pacid=23152083 polypeptide=Lus10029608 locus=Lus10029608.g ID=Lus10029608.BGIv1.0 annot-version=v1.0 MEDLISSLAVFKETVPLSLSTFETCLVIETSKGQMTKDLEERLANRKEQLTTLDAEVFKLGEEGSKLDVEIQQSTDRRAAILERVDSTEVELEKANQEAS KELDELKKENDELKQAVEKRM

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
					Lus10029608 [exp]	0	1
AT5G38200			Class I glutamine amidotransfe...		Lus10039726 [exp]	15.7	0.8396
AT5G06760		AtLEA4-5, LEA4-...	Late Embryogenesis Abundant 4-...		Lus10012009 [exp]	51.2	0.8174
AT1G80320			2-oxoglutarate (2OG) and Fe(II...		Lus10041279 [exp]	233.1	0.7833
AT1G52820			2-oxoglutarate (2OG) and Fe(II...		Lus10041280 [exp]	253.4	0.7797

Compare expression of checked genes

Lus10029608 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.