Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	No hit found
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10042684 [exp] 233 / 2e-80 ND / Lus10029617 [exp] 215 / 3e-73 ND / Lus10032788 [exp] 209 / 5e-71 ND 36 / 0.007 Lus10032770 [exp] 204 / 6e-69 ND / Lus10003755 [exp] 137 / 2e-42 ND 37 / 0.002 Lus10003753 [exp] 130 / 9e-40 ND / Lus10003754 [exp] 129 / 1e-39 AT1G04520 39 / 3e-04 plasmodesmata-located protein 2 (.1) Lus10008314 [exp] 126 / 3e-38 ND / Lus10029618 [exp] 126 / 4e-38 ND /
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.005G208400 [exp] 37 / 0.0007 AT5G48540 52 / 1e-08 receptor-like protein kinase-related family protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF01657 [flax] [poplar] Stress-antifung Salt stress response/antifungal
Representative CDS sequence Show only first row Show all	>Lus10029619 pacid=23152135 polypeptide=Lus10029619 locus=Lus10029619.g ID=Lus10029619.BGIv1.0 annot-version=v1.0 ATGGTGGCAGCAGTTCTAATTTTCGCTATTTTGAGTGTCGTTGACTGTGCGGATAAAAGCGTCATCAACGGACCATATTGCGTTAAGAAATCTTTCGATG GAGATTACAACAAGGATGCATCGCGTCTTGTGGATATCCTTGTGGATGAAACCAAGAACAAGTACAGGACGATGGATCATGAAGAATACAGGTACTATCA CAGCTACCCCAATACTGACTCGGGTTCCGTCCTCGGTGGGGGCTATTGCGATGGACACCTGACGAAATGGGGATGCGGCAGTTGCCTTGGCTCCGCGAGG GACAAAATCAAGTCCCGCTGCGATCGTACCTTTGAGGCTAGCGTTACACTCGCTGATTGCTCCCTCTGGTTTAGGAAGATCGTACCTTGA
AA sequence Show only first row Show all	>Lus10029619 pacid=23152135 polypeptide=Lus10029619 locus=Lus10029619.g ID=Lus10029619.BGIv1.0 annot-version=v1.0 MVAAVLIFAILSVVDCADKSVINGPYCVKKSFDGDYNKDASRLVDILVDETKNKYRTMDHEEYRYYHSYPNTDSGSVLGGGYCDGHLTKWGCGSCLGSAR DKIKSRCDRTFEASVTLADCSLWFRKIVP

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
					Lus10029619 [exp]	0	1
AT2G45560		CYP76C1	"cytochrome P450, family 76, s...		Lus10027431 [exp]	3.0	0.8033
AT3G22840		ELIP1	EARLY LIGHT-INDUCABLE PROTEIN,...		Lus10039378 [exp]	6.9	0.8157
AT5G06530		AtABCG22, ABCG2...	Arabidopsis thaliana ATP-bindi...		Lus10015993 [exp]	8.8	0.8128
AT3G04120		GAPC1, GAPC-1, ...	glyceraldehyde-3-phosphate deh...		Lus10032071 [exp]	14.1	0.7296
AT3G16910		AAE7, ACN1	ACETATE NON-UTILIZING 1, acyl-...		Lus10016869 [exp]	15.3	0.7758
AT3G10980		SAG20, WI12, AT...	PLAC8 family protein (.1)		Lus10010219 [exp]	15.6	0.7186
AT3G03430			Calcium-binding EF-hand family...		Lus10033587 [exp]	17.5	0.7816
AT2G45550		CYP76C4	"cytochrome P450, family 76, s...		Lus10005765 [exp]	24.4	0.7679
					Lus10016101 [exp]	26.3	0.7563
AT3G49220			Plant invertase/pectin methyle...		Lus10022412 [exp]	26.8	0.7580

Compare expression of checked genes

Lus10029619 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.