Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT1G03430 63 / 8e-14 AHP5 histidine-containing phosphotransfer factor 5 (.1) AT5G39340 61 / 5e-13 ATHP2, AHP3 ARABIDOPSIS THALIANA HISTIDINE-CONTAINING PHOSPHOTRANSMITTER 2, histidine-containing phosphotransmitter 3 (.1) AT3G29350 57 / 7e-12 ATHP1, AHP2 histidine-containing phosphotransmitter 2 (.1.2) AT3G16360 54 / 3e-10 AHP4 HPT phosphotransmitter 4 (.1.2) AT3G21510 48 / 6e-08 ATHP3, AHP1 histidine-containing phosphotransmitter 1 (.1) AT4G04402 0 / 1 two-component phosphorelay mediator, putative (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10042680 [exp] 123 / 4e-37 AT1G03430 142 / 2e-43 histidine-containing phosphotransfer factor 5 (.1) Lus10002256 [exp] 62 / 1e-13 AT3G21510 154 / 3e-49 histidine-containing phosphotransmitter 1 (.1) Lus10012777 [exp] 59 / 6e-12 AT3G21510 216 / 5e-73 histidine-containing phosphotransmitter 1 (.1) Lus10033999 [exp] 58 / 8e-12 AT3G21510 216 / 3e-73 histidine-containing phosphotransmitter 1 (.1) Lus10000926 [exp] 57 / 3e-11 AT3G21510 181 / 3e-59 histidine-containing phosphotransmitter 1 (.1) Lus10027965 [exp] 52 / 8e-10 AT1G03430 119 / 2e-35 histidine-containing phosphotransfer factor 5 (.1) Lus10003256 [exp] 43 / 4e-06 AT1G03430 105 / 1e-29 histidine-containing phosphotransfer factor 5 (.1) Lus10035596 [exp] 42 / 1e-05 AT3G16360 103 / 5e-29 HPT phosphotransmitter 4 (.1.2)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.006G098200 [exp] 72 / 2e-17 AT1G03430 207 / 7e-70 histidine-containing phosphotransfer factor 5 (.1) Potri.016G113500 [exp] 72 / 2e-17 AT1G03430 210 / 1e-70 histidine-containing phosphotransfer factor 5 (.1) Potri.013G028300 [exp] 57 / 1e-11 AT3G21510 183 / 2e-60 histidine-containing phosphotransmitter 1 (.1) Potri.005G040400 [exp] 55 / 9e-11 AT3G21510 181 / 1e-59 histidine-containing phosphotransmitter 1 (.1) Potri.014G136200 [exp] 54 / 2e-10 AT1G03430 163 / 2e-52 histidine-containing phosphotransfer factor 5 (.1) Potri.010G027100 [exp] 48 / 4e-08 AT3G21510 206 / 5e-69 histidine-containing phosphotransmitter 1 (.1) Potri.008G197600 [exp] 47 / 1e-07 AT3G21510 193 / 3e-64 histidine-containing phosphotransmitter 1 (.1) Potri.018G046800 [exp] 44 / 1e-06 AT3G16360 170 / 3e-55 HPT phosphotransmitter 4 (.1.2) Potri.001G189900 [exp] 43 / 4e-06 AT3G16360 239 / 1e-82 HPT phosphotransmitter 4 (.1.2) Potri.006G236300 [exp] 42 / 1e-05 AT3G16360 199 / 1e-66 HPT phosphotransmitter 4 (.1.2)
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10029623 pacid=23152086 polypeptide=Lus10029623 locus=Lus10029623.g ID=Lus10029623.BGIv1.0 annot-version=v1.0 ATGGAGCCAATTGATTTGAGGGATTTAAGACTGTTTTTGATTATGTACGGAGTGGTTTTTGCTGAACTTTACTTCGTTGCCGGGGGAGTTGTGAAGGGAT TTTTGGACGGGGAGTTCACTAGGCTTCTGGAGCTTCAAGACAGGAGTTGTCCTGATTTTGTGATCAAGGTTGCTAAAGTCTTCTTCAAGGACTGTCAGCA GATTATTAACGACTTGGATATTGCTCTCTTCGGTGCCGCAAGGATGCGTGAGATATGCGTCAAATTAAGACCTCTTTGCGAGTCACAGAATCGTAACGGG TGA
AA sequence Show only first row Show all	>Lus10029623 pacid=23152086 polypeptide=Lus10029623 locus=Lus10029623.g ID=Lus10029623.BGIv1.0 annot-version=v1.0 MEPIDLRDLRLFLIMYGVVFAELYFVAGGVVKGFLDGEFTRLLELQDRSCPDFVIKVAKVFFKDCQQIINDLDIALFGAARMREICVKLRPLCESQNRNG

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT1G03430		AHP5	histidine-containing phosphotr...		Lus10029623 [exp]	0	1
AT1G78760			F-box/RNI-like superfamily pro...		Lus10024701 [exp]	14.0	0.7110
AT1G47890		AtRLP7	receptor like protein 7 (.1)		Lus10016402 [exp]	24.3	0.6592
AT2G20495			unknown protein		Lus10024909 [exp]	36.5	0.6590
AT5G62575		SDH7B, SDH7	succinate dehydrogenase 7B, su...		Lus10004231 [exp]	69.6	0.5814
AT5G23210		SCPL34	serine carboxypeptidase-like 3...		Lus10017392 [exp]	75.8	0.6164
					Lus10029490 [exp]	77.4	0.5999
AT3G51820		PDE325, ATG4, G...	PIGMENT DEFECTIVE 325, UbiA pr...		Lus10002850 [exp]	84.1	0.5774
AT4G33355			Bifunctional inhibitor/lipid-t...		Lus10029445 [exp]	96.3	0.5700
					Lus10010387 [exp]	96.9	0.5624
AT2G19330		PIRL6	plant intracellular ras group-...		Lus10035622 [exp]	113.5	0.5846

Compare expression of checked genes

Lus10029623 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.