Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT1G02820 47 / 2e-08 Late embryogenesis abundant 3 (LEA3) family protein (.1) AT4G02380 47 / 3e-08 SAG21, ATLEA5 Arabidopsis thaliana late embryogenensis abundant like 5, senescence-associated gene 21 (.1.2) AT3G53770 39 / 7e-05 late embryogenesis abundant 3 (LEA3) family protein (.1), late embryogenesis abundant 3 (LEA3) family protein (.2) AT4G15910 37 / 0.0003 ATDI21 drought-induced 21 (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10042672 [exp] 140 / 3e-45 AT4G02380 63 / 2e-14 Arabidopsis thaliana late embryogenensis abundant like 5, senescence-associated gene 21 (.1.2) Lus10027986 [exp] 64 / 1e-14 AT1G02820 78 / 3e-20 Late embryogenesis abundant 3 (LEA3) family protein (.1) Lus10008170 [exp] 60 / 4e-13 AT4G02380 83 / 3e-22 Arabidopsis thaliana late embryogenensis abundant like 5, senescence-associated gene 21 (.1.2) Lus10027987 [exp] 56 / 6e-12 AT1G02820 67 / 5e-16 Late embryogenesis abundant 3 (LEA3) family protein (.1) Lus10008169 [exp] 55 / 2e-11 AT1G02820 66 / 6e-16 Late embryogenesis abundant 3 (LEA3) family protein (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.002G203500 [exp] 76 / 2e-19 AT4G02380 74 / 1e-18 Arabidopsis thaliana late embryogenensis abundant like 5, senescence-associated gene 21 (.1.2) Potri.014G127700 [exp] 69 / 5e-17 AT4G02380 79 / 1e-20 Arabidopsis thaliana late embryogenensis abundant like 5, senescence-associated gene 21 (.1.2)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF03242 [flax] [poplar] LEA_3 Late embryogenesis abundant protein
Representative CDS sequence Show only first row Show all	>Lus10029634 pacid=23152117 polypeptide=Lus10029634 locus=Lus10029634.g ID=Lus10029634.BGIv1.0 annot-version=v1.0 ATGGCTCTCTCTTTCTCCAACGCTAAGATCCTTTCTGCTGCTCTGACCAAGGCAATCAACGGAAGCAGAGGATTCTCCGCTGCCGCCGCTGCTGGGAAAG GCGGGATGGTGAAGAAAACCGGGGAAGACGTCTCGAGCAAGAAGGTGTTCAAACCAATTCAAAGGGTTTCCTGGGTTCCTGACTCCCGAACTGGTTTCTA CAGACCCGAGAACGTTGCCGAGGATATTTACGACGCCGCTTACCAACGTGCTCTCCACTTGAAGAACTAA
AA sequence Show only first row Show all	>Lus10029634 pacid=23152117 polypeptide=Lus10029634 locus=Lus10029634.g ID=Lus10029634.BGIv1.0 annot-version=v1.0 MALSFSNAKILSAALTKAINGSRGFSAAAAAGKGGMVKKTGEDVSSKKVFKPIQRVSWVPDSRTGFYRPENVAEDIYDAAYQRALHLKN

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT4G02380		SAG21, ATLEA5	Arabidopsis thaliana late embr...		Lus10029634 [exp]	0	1
AT5G02420			unknown protein		Lus10037925 [exp]	2.8	0.8502
AT5G19790	AP2_ERF	RAP2.11	related to AP2 11 (.1)		Lus10041372 [exp]	4.1	0.8543
AT5G40190			RNA ligase/cyclic nucleotide p...		Lus10039477 [exp]	5.2	0.8462
AT4G37260	MYB	ATMYB73	myb domain protein 73 (.1)		Lus10030336 [exp]	9.2	0.8409
AT2G39705		RTFL8, DVL11	DEVIL 11, ROTUNDIFOLIA like 8 ...		Lus10024323 [exp]	13.6	0.8312
AT3G17130			Plant invertase/pectin methyle...		Lus10017074 [exp]	14.7	0.8055
AT4G39510		CYP96A12	"cytochrome P450, family 96, s...		Lus10018159 [exp]	16.6	0.7555
					Lus10041371 [exp]	16.7	0.8205
AT3G18490			Eukaryotic aspartyl protease f...		Lus10032482 [exp]	18.3	0.8382
AT5G59030		COPT1	copper transporter 1 (.1)		Lus10016464 [exp]	25.6	0.7740

Compare expression of checked genes

Lus10029634 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.