Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT3G30280 55 / 9e-10 HXXXD-type acyl-transferase family protein (.1) AT4G15390 54 / 2e-09 HXXXD-type acyl-transferase family protein (.1) AT5G47950 52 / 1e-08 HXXXD-type acyl-transferase family protein (.1) AT1G31490 49 / 1e-07 HXXXD-type acyl-transferase family protein (.1) AT5G16410 48 / 3e-07 HXXXD-type acyl-transferase family protein (.1) AT1G24430 48 / 3e-07 HXXXD-type acyl-transferase family protein (.1) AT1G24420 47 / 7e-07 HXXXD-type acyl-transferase family protein (.1) AT3G26040 47 / 7e-07 HXXXD-type acyl-transferase family protein (.1) AT1G32910 46 / 1e-06 HXXXD-type acyl-transferase family protein (.1) AT1G65450 45 / 2e-06 HXXXD-type acyl-transferase family protein (.1.2.3)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10004441 [exp] 119 / 9e-33 AT3G26040 196 / 2e-57 HXXXD-type acyl-transferase family protein (.1) Lus10000319 [exp] 115 / 5e-31 AT3G26040 198 / 2e-58 HXXXD-type acyl-transferase family protein (.1) Lus10017702 [exp] 100 / 5e-27 AT4G15390 118 / 1e-30 HXXXD-type acyl-transferase family protein (.1) Lus10034019 [exp] 99 / 1e-26 AT5G47950 84 / 2e-18 HXXXD-type acyl-transferase family protein (.1) Lus10042994 [exp] 101 / 5e-26 AT3G26040 184 / 3e-53 HXXXD-type acyl-transferase family protein (.1) Lus10032497 [exp] 89 / 1e-23 AT4G15390 62 / 2e-12 HXXXD-type acyl-transferase family protein (.1) Lus10016353 [exp] 91 / 3e-22 AT3G26040 201 / 1e-59 HXXXD-type acyl-transferase family protein (.1) Lus10002893 [exp] 85 / 5e-20 AT5G47950 195 / 2e-57 HXXXD-type acyl-transferase family protein (.1) Lus10012759 [exp] 81 / 1e-18 AT3G26040 209 / 3e-62 HXXXD-type acyl-transferase family protein (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.011G124184 [exp] 69 / 1e-14 AT3G26040 278 / 5e-89 HXXXD-type acyl-transferase family protein (.1) Potri.011G124300 [exp] 69 / 1e-14 AT3G26040 278 / 5e-89 HXXXD-type acyl-transferase family protein (.1) Potri.011G124128 [exp] 68 / 3e-14 AT3G26040 282 / 1e-90 HXXXD-type acyl-transferase family protein (.1) Potri.011G124156 [exp] 68 / 3e-14 AT3G26040 284 / 2e-91 HXXXD-type acyl-transferase family protein (.1) Potri.011G124268 [exp] 68 / 3e-14 AT3G26040 281 / 2e-90 HXXXD-type acyl-transferase family protein (.1) Potri.011G124500 [exp] 68 / 3e-14 AT3G26040 281 / 2e-90 HXXXD-type acyl-transferase family protein (.1) Potri.007G139400 [exp] 65 / 4e-13 AT3G26040 252 / 7e-80 HXXXD-type acyl-transferase family protein (.1) Potri.008G033500 [exp] 62 / 3e-12 AT3G26040 290 / 3e-93 HXXXD-type acyl-transferase family protein (.1) Potri.008G034300 [exp] 62 / 5e-12 AT3G26040 280 / 1e-89 HXXXD-type acyl-transferase family protein (.1) Potri.008G034100 [exp] 62 / 5e-12 AT3G26040 270 / 4e-86 HXXXD-type acyl-transferase family protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0149 [flax] [poplar] CoA-acyltrans PF02458 [flax] [poplar] Transferase Transferase family
Representative CDS sequence Show only first row Show all	>Lus10029647 pacid=23152153 polypeptide=Lus10029647 locus=Lus10029647.g ID=Lus10029647.BGIv1.0 annot-version=v1.0 ATGGGGAGCATTTTGCAGAAAAGGCTCAACGGCTTGATTCGGGCACCAGCATCAGCAGCACCGCCGAATTTGCAAGTCCTCGATCGCTTGCTTCCTATTC ACCCGCCTTTCCGCCTCCACCAGAATAACGGTCCACAACTCGCCGTCCAAGTCAACACATTCGAGTGCGGCGGCGTGGCGGTTGGTCTGTCGTTCAAAAA CCGCATCATGGACGGAGGTTCCATCGCCGTATTCCTCGAAACATGGGCCGCAATTTCCAACAACAAAGCCGTACATCATCCTCCTGATTTATTCAACGGA TGCTCTGTTTTTCAACCTCGTGAAGAATCCATTCCATCCGAGATCCAAACATTCGCGGAGAAGCTCTACTTCAAGGATTCTCGTAGTGTCTAG
AA sequence Show only first row Show all	>Lus10029647 pacid=23152153 polypeptide=Lus10029647 locus=Lus10029647.g ID=Lus10029647.BGIv1.0 annot-version=v1.0 MGSILQKRLNGLIRAPASAAPPNLQVLDRLLPIHPPFRLHQNNGPQLAVQVNTFECGGVAVGLSFKNRIMDGGSIAVFLETWAAISNNKAVHHPPDLFNG CSVFQPREESIPSEIQTFAEKLYFKDSRSV

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT3G30280			HXXXD-type acyl-transferase fa...		Lus10029647 [exp]	0	1
AT5G52280			Myosin heavy chain-related pro...		Lus10029303 [exp]	5.7	0.7305
AT1G25290		ATRBL10	RHOMBOID-like protein 10 (.1.2...		Lus10022969 [exp]	13.7	0.6995
AT3G07020		UGT80A2, SGT	UDP-glucosyl transferase 80A2,...		Lus10022815 [exp]	21.3	0.7179
AT3G57270		BG1	"beta-1,3-glucanase 1", beta-1...		Lus10014110 [exp]	22.5	0.6721
AT2G38150			alpha 1,4-glycosyltransferase ...		Lus10004828 [exp]	31.7	0.6703
AT5G63040			unknown protein		Lus10039957 [exp]	43.4	0.6822
AT4G17720			RNA-binding (RRM/RBD/RNP motif...		Lus10035919 [exp]	46.0	0.5609
AT1G15170			MATE efflux family protein (.1...		Lus10018135 [exp]	68.7	0.6632
AT2G43950		OEP37, ATOEP37	ARABIDOPSIS CHLOROPLAST OUTER ...		Lus10013621 [exp]	69.6	0.6144
					Lus10033349 [exp]	70.5	0.5879

Compare expression of checked genes

Lus10029647 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.