Lus10029651 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT2G48150 274 / 2e-95 ATGPX4 glutathione peroxidase 4 (.1)
AT3G63080 262 / 6e-91 ATGPX5, MEE42 maternal effect embryo arrest 42, glutathione peroxidase 5 (.1)
AT4G11600 240 / 2e-81 LSC803, PHGPX, ATGPX6 glutathione peroxidase 6 (.1)
AT4G31870 217 / 4e-72 ATGPX7 glutathione peroxidase 7 (.1)
AT2G25080 216 / 9e-72 ATGPX1 glutathione peroxidase 1 (.1)
AT2G31570 213 / 1e-71 ATGPX2 glutathione peroxidase 2 (.1)
AT1G63460 204 / 6e-68 ATGPX8 glutathione peroxidase 8 (.1)
AT2G43350 196 / 2e-64 ATGPX3 glutathione peroxidase 3 (.1.2)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10008022 245 / 6e-84 AT4G11600 301 / 1e-105 glutathione peroxidase 6 (.1)
Lus10008537 243 / 2e-83 AT4G11600 299 / 1e-104 glutathione peroxidase 6 (.1)
Lus10008499 244 / 6e-83 AT4G11600 307 / 2e-106 glutathione peroxidase 6 (.1)
Lus10042692 215 / 4e-73 AT2G48150 188 / 2e-62 glutathione peroxidase 4 (.1)
Lus10027021 216 / 1e-72 AT2G31570 266 / 2e-92 glutathione peroxidase 2 (.1)
Lus10000603 214 / 4e-72 AT4G11600 256 / 9e-88 glutathione peroxidase 6 (.1)
Lus10008023 218 / 6e-72 AT1G63460 265 / 9e-91 glutathione peroxidase 8 (.1)
Lus10026887 216 / 1e-71 AT4G31870 332 / 3e-116 glutathione peroxidase 7 (.1)
Lus10000601 210 / 3e-70 AT1G63460 256 / 2e-88 glutathione peroxidase 8 (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.014G138800 278 / 5e-97 AT2G48150 271 / 1e-94 glutathione peroxidase 4 (.1)
Potri.003G126100 248 / 4e-84 AT4G11600 307 / 9e-107 glutathione peroxidase 6 (.1)
Potri.001G105200 240 / 4e-82 AT4G11600 298 / 3e-104 glutathione peroxidase 6 (.1)
Potri.001G105100 219 / 9e-74 AT1G63460 283 / 5e-99 glutathione peroxidase 8 (.1)
Potri.006G265400 221 / 1e-73 AT2G25080 343 / 6e-121 glutathione peroxidase 1 (.1)
Potri.007G126600 219 / 2e-73 AT2G31570 281 / 1e-97 glutathione peroxidase 2 (.1)
Potri.018G017500 149 / 2e-46 AT2G25080 209 / 4e-69 glutathione peroxidase 1 (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0172 Thioredoxin PF00255 GSHPx Glutathione peroxidase
Representative CDS sequence
>Lus10029651 pacid=23152157 polypeptide=Lus10029651 locus=Lus10029651.g ID=Lus10029651.BGIv1.0 annot-version=v1.0
ATGGGGATTTCTGGGTCAGTGCCGGAGAAATCAATCCACGAATTCACCGTCAAGGATAGCAGAGGTAAGGATGTGGAGCTCAGCATCTATCAGGGGAAGG
TTCTTCTGGTTGTTAACGTCGCTTCCAAATGCGGTTTCACTGATACAAATTACACCCAGTTGACTGATCTCTATCAAAAATACAAGGACCAAGGTTTTGA
AATTCTGGCATTCCCTTGCAACCAATTCTTGAACCAGGAGCCTGGCACAAGTGAGGAGGCACAGGAGTTTGCTTGTACTAGATACAAGGCTGAGTATCCA
ATTTTCCAGAAGGTACGTGTGAATGGGAAACAGGCTGCACCACTGTACAAATTCCTAAAGACTTACAAAAACGGTTTCATGGGCTCAAGGATAAAGTGGA
ATTTCACCAAGTTCCTCATCAGCAAAGAAGGACAAGTGGTCGGTCGGTTTGGCCCGACCGTTTCCCCTCTGTCGATGGAGACACACATCAAGAAAGAACT
GGGAGACCAAGAATGA
AA sequence
>Lus10029651 pacid=23152157 polypeptide=Lus10029651 locus=Lus10029651.g ID=Lus10029651.BGIv1.0 annot-version=v1.0
MGISGSVPEKSIHEFTVKDSRGKDVELSIYQGKVLLVVNVASKCGFTDTNYTQLTDLYQKYKDQGFEILAFPCNQFLNQEPGTSEEAQEFACTRYKAEYP
IFQKVRVNGKQAAPLYKFLKTYKNGFMGSRIKWNFTKFLISKEGQVVGRFGPTVSPLSMETHIKKELGDQE

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT2G48150 ATGPX4 glutathione peroxidase 4 (.1) Lus10029651 0 1
AT1G14290 SBH2 sphingoid base hydroxylase 2 (... Lus10030481 1.4 0.8642
AT1G14290 SBH2 sphingoid base hydroxylase 2 (... Lus10012832 6.3 0.8192
AT4G13530 unknown protein Lus10003531 10.6 0.8352
AT2G04520 Nucleic acid-binding, OB-fold-... Lus10000920 15.3 0.8382
AT4G30360 ATCNGC17 cyclic nucleotide-gated channe... Lus10023203 16.6 0.8444
AT1G53400 Ubiquitin domain-containing pr... Lus10015233 18.0 0.8004
AT1G79660 unknown protein Lus10024088 21.9 0.8233
AT2G25310 Protein of unknown function (D... Lus10001919 23.0 0.7917
AT4G00620 EMB3127 EMBRYO DEFECTIVE 3127, Amino a... Lus10017822 27.2 0.8277
AT2G37480 unknown protein Lus10024420 27.8 0.8228

Lus10029651 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.