Lus10029653 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT5G45890 143 / 1e-42 SAG12 senescence-associated gene 12 (.1)
AT1G20850 137 / 2e-40 XCP2 xylem cysteine peptidase 2 (.1)
AT5G50260 136 / 8e-40 CEP1 cysteine endopeptidase 1, Cysteine proteinases superfamily protein (.1)
AT3G48340 136 / 9e-40 CEP2 cysteine endopeptidase 2, Cysteine proteinases superfamily protein (.1)
AT5G43060 130 / 6e-37 Granulin repeat cysteine protease family protein (.1)
AT3G19390 128 / 7e-36 Granulin repeat cysteine protease family protein (.1)
AT4G35350 126 / 8e-36 XCP1 xylem cysteine peptidase 1 (.1.2)
AT4G36880 125 / 3e-35 CP1 cysteine proteinase1 (.1)
AT1G47128 123 / 5e-34 RD21A, RD21 RESPONSIVE TO DEHYDRATION 21A, responsive to dehydration 21, Granulin repeat cysteine protease family protein (.1)
AT3G19400 120 / 9e-34 Cysteine proteinases superfamily protein (.1.2)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10042691 221 / 4e-74 AT5G50260 321 / 5e-110 cysteine endopeptidase 1, Cysteine proteinases superfamily protein (.1)
Lus10029649 220 / 2e-72 AT5G45890 386 / 2e-134 senescence-associated gene 12 (.1)
Lus10042693 218 / 2e-71 AT5G45890 379 / 1e-131 senescence-associated gene 12 (.1)
Lus10029658 214 / 3e-70 AT5G45890 383 / 4e-133 senescence-associated gene 12 (.1)
Lus10006542 166 / 2e-51 AT5G45890 391 / 2e-136 senescence-associated gene 12 (.1)
Lus10026362 164 / 8e-51 AT5G45890 396 / 2e-138 senescence-associated gene 12 (.1)
Lus10020722 164 / 2e-50 AT5G45890 392 / 1e-136 senescence-associated gene 12 (.1)
Lus10020730 163 / 4e-50 AT5G45890 392 / 1e-136 senescence-associated gene 12 (.1)
Lus10003275 162 / 8e-50 AT5G45890 392 / 1e-136 senescence-associated gene 12 (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.011G064900 157 / 4e-48 AT5G45890 401 / 3e-140 senescence-associated gene 12 (.1)
Potri.007G075300 153 / 3e-46 AT5G45890 406 / 6e-142 senescence-associated gene 12 (.1)
Potri.007G076000 152 / 3e-46 AT5G45890 407 / 2e-142 senescence-associated gene 12 (.1)
Potri.005G088600 153 / 4e-46 AT5G45890 406 / 8e-142 senescence-associated gene 12 (.1)
Potri.007G075900 153 / 4e-46 AT5G45890 411 / 7e-144 senescence-associated gene 12 (.1)
Potri.007G076100 153 / 4e-46 AT5G45890 411 / 7e-144 senescence-associated gene 12 (.1)
Potri.005G089100 151 / 1e-45 AT5G45890 405 / 1e-141 senescence-associated gene 12 (.1)
Potri.013G118200 149 / 5e-45 AT5G45890 387 / 2e-135 senescence-associated gene 12 (.1)
Potri.013G126100 149 / 1e-44 AT5G45890 386 / 2e-134 senescence-associated gene 12 (.1)
Potri.015G087400 149 / 2e-44 AT5G50260 550 / 0.0 cysteine endopeptidase 1, Cysteine proteinases superfamily protein (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0125 Peptidase_CA PF00112 Peptidase_C1 Papain family cysteine protease
Representative CDS sequence
>Lus10029653 pacid=23152145 polypeptide=Lus10029653 locus=Lus10029653.g ID=Lus10029653.BGIv1.0 annot-version=v1.0
ATGAAGATCTCAACAGCGAAGTTGGTATCGCTTTCGGAGCAAGAACTGATCGACTGCGACAGAACGAGTAACGACCAAGGATGCAACAGAGGCTTCATGG
ATGACGCTTTTCAATATGTGAAGAGCAAAGGCCTCACAACTGAATCCAACTATCCTTATACGGTAGCAGATGGAACTTGCAACGCGGTCAAGACAAACCC
TTCTTCGGACAAGATCAACGGTTACGAGGATGTACCTGCCAACGACGAGAAATCGATGTTTAAGGCCGCGGCTAACCAGCCTATCTCTGTGGCCATTGAT
GCCAGTGGCTCTGCTTTCCAGTTTTACTCGAGTGGAATGTTCATCGGAGTGTGGCACGGATTTGGATCATGGTGTGGCTGTGGTAGGATCATAGTTCAAG
TATGA
AA sequence
>Lus10029653 pacid=23152145 polypeptide=Lus10029653 locus=Lus10029653.g ID=Lus10029653.BGIv1.0 annot-version=v1.0
MKISTAKLVSLSEQELIDCDRTSNDQGCNRGFMDDAFQYVKSKGLTTESNYPYTVADGTCNAVKTNPSSDKINGYEDVPANDEKSMFKAAANQPISVAID
ASGSAFQFYSSGMFIGVWHGFGSWCGCGRIIVQV

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT5G45890 SAG12 senescence-associated gene 12 ... Lus10029653 0 1

Lus10029653 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.