Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	No hit found
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10023773 [exp] 150 / 4e-48 ND / Lus10004093 [exp] 132 / 6e-41 ND 39 / 6e-04 Lus10014888 [exp] 100 / 5e-28 ND 39 / 7e-04 Lus10032472 [exp] 96 / 3e-27 ND 35 / 0.004 Lus10029497 [exp] 92 / 9e-25 ND / Lus10022142 [exp] 85 / 1e-22 ND / Lus10011629 [exp] 66 / 6e-15 ND 39 / 6e-04 Lus10039269 [exp] 54 / 4e-10 ND / Lus10013815 [exp] 0 / 1 ND /
Poplar homologues Show only best Show top 10	No hit found
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0167 [flax] [poplar] Zn_Beta_Ribbon PF06839 [flax] [poplar] zf-GRF GRF zinc finger
Representative CDS sequence Show only first row Show all	>Lus10029656 pacid=23152050 polypeptide=Lus10029656 locus=Lus10029656.g ID=Lus10029656.BGIv1.0 annot-version=v1.0 ATGGAAAACAAGCATCCTCAATTGAACACAAGTGCGCAGATATTGGTGAAACTAATTCTTCCTTTGAAGGATGCTTTCAGGTATGACGATGATGACGTTT TCTGTCTCTGTGGGTTGCGTGTATCCCGACGTATATCACACACAGCGAGCAATTCAGGGAAGAAATTCTTTGGTTGTCCCCGTTATGTTTCACTGGTAGC TTCACTGAAAGAAAAGCAAGAGTTGGTGCAAATGGTTGAGAGATTGCAGCCGGAAGTTAGGGAACTTCAAGAAGTTAATGTGCAGTTGCAAGCACAAATC GGGGAGGTCAGTTGCTTCAGCTAG
AA sequence Show only first row Show all	>Lus10029656 pacid=23152050 polypeptide=Lus10029656 locus=Lus10029656.g ID=Lus10029656.BGIv1.0 annot-version=v1.0 MENKHPQLNTSAQILVKLILPLKDAFRYDDDDVFCLCGLRVSRRISHTASNSGKKFFGCPRYVSLVASLKEKQELVQMVERLQPEVRELQEVNVQLQAQI GEVSCFS

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
					Lus10029656 [exp]	0	1
AT2G40435			unknown protein		Lus10029251 [exp]	1.4	0.8969
AT4G37925		NdhM, NDH-M	NADH dehydrogenase-like comple...		Lus10042759 [exp]	3.2	0.9060
AT3G44800			Meprin and TRAF (MATH) homolog...		Lus10013547 [exp]	4.9	0.8684
AT2G33030		AtRLP25	receptor like protein 25 (.1)		Lus10003462 [exp]	9.0	0.7888
AT1G29270			unknown protein		Lus10007304 [exp]	11.0	0.8298
AT4G18780		LEW2, IRX1, ATC...	LEAF WILTING 2, IRREGULAR XYLE...		Lus10022449 [exp]	11.3	0.8811
					Lus10007473 [exp]	14.1	0.7817
AT1G70760		NdhL, CRR23	NADH dehydrogenase-like comple...		Lus10012886 [exp]	17.6	0.8882
AT3G47650			DnaJ/Hsp40 cysteine-rich domai...		Lus10002020 [exp]	18.3	0.8717
AT4G26555			FKBP-like peptidyl-prolyl cis-...		Lus10027129 [exp]	19.3	0.8771

Compare expression of checked genes

Lus10029656 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.