Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT1G24620 100 / 1e-27 EF hand calcium-binding protein family (.1) AT1G66400 70 / 4e-16 CML23 calmodulin like 23 (.1) AT5G37770 67 / 5e-15 CML24, TCH2 TOUCH 2, CALMODULIN-LIKE 24, EF hand calcium-binding protein family (.1) AT5G17470 61 / 1e-12 EF hand calcium-binding protein family (.1) AT1G18210 59 / 7e-12 Calcium-binding EF-hand family protein (.1.2) AT1G73630 57 / 6e-11 EF hand calcium-binding protein family (.1) AT2G41110 56 / 1e-10 ACAM-2, ATCAL5, CAM2 calmodulin 2 (.1.2) AT2G27030 56 / 1e-10 CAM5, CAM2, ACAM-2, ACAM-5 calmodulin 5 (.1.2.3) AT3G56800 56 / 1e-10 ACAM-3, CAM3 calmodulin 3 (.1) AT3G43810 56 / 1e-10 CAM7 calmodulin 7 (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10028913 [exp] 153 / 9e-49 AT1G24620 204 / 5e-68 EF hand calcium-binding protein family (.1) Lus10004330 [exp] 149 / 4e-47 AT1G24620 207 / 2e-69 EF hand calcium-binding protein family (.1) Lus10024574 [exp] 111 / 3e-32 AT1G24620 143 / 4e-44 EF hand calcium-binding protein family (.1) Lus10009127 [exp] 66 / 1e-13 AT1G66400 147 / 2e-44 calmodulin like 23 (.1) Lus10028516 [exp] 62 / 2e-13 AT1G66400 118 / 4e-35 calmodulin like 23 (.1) Lus10027081 [exp] 61 / 2e-12 AT1G18210 131 / 2e-39 Calcium-binding EF-hand family protein (.1.2) Lus10019863 [exp] 58 / 5e-11 AT2G15680 233 / 9e-79 calmodulin-like 30, Calcium-binding EF-hand family protein (.1) Lus10009059 [exp] 57 / 5e-11 AT1G18210 197 / 3e-65 Calcium-binding EF-hand family protein (.1.2) Lus10027283 [exp] 56 / 2e-10 AT2G27030 300 / 2e-106 calmodulin 5 (.1.2.3)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.008G134300 [exp] 107 / 3e-30 AT1G24620 219 / 2e-73 EF hand calcium-binding protein family (.1) Potri.010G107100 [exp] 107 / 4e-30 AT1G24620 220 / 2e-73 EF hand calcium-binding protein family (.1) Potri.017G126200 [exp] 64 / 8e-14 AT1G66400 155 / 5e-49 calmodulin like 23 (.1) Potri.004G089400 [exp] 64 / 1e-13 AT1G66400 157 / 7e-50 calmodulin like 23 (.1) Potri.012G041000 [exp] 60 / 2e-12 AT5G37780 283 / 9e-100 TOUCH 1, calmodulin 1 (.1.2.3) Potri.015G039500 [exp] 60 / 6e-12 AT1G18210 189 / 6e-62 Calcium-binding EF-hand family protein (.1.2) Potri.015G032600 [exp] 59 / 8e-12 AT5G37780 284 / 3e-100 TOUCH 1, calmodulin 1 (.1.2.3) Potri.012G048200 [exp] 59 / 8e-12 AT1G18210 188 / 8e-62 Calcium-binding EF-hand family protein (.1.2) Potri.014G070700 [exp] 59 / 2e-11 AT1G18210 94 / 2e-24 Calcium-binding EF-hand family protein (.1.2) Potri.016G024700 [exp] 56 / 1e-10 AT3G43810 300 / 2e-106 calmodulin 7 (.1)
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10029660 pacid=23152040 polypeptide=Lus10029660 locus=Lus10029660.g ID=Lus10029660.BGIv1.0 annot-version=v1.0 ATGATCATGTCCAGCCTCGACCACAGTGCCAACGACGACGAGCTCCAGAAAAATGATCACCGAGTTCTATGCCAACGGGGACGGGTTCATCGATTTCGAC GAGTTCGTGGCAATGAACATCGAGGGGTCGGGTCCGAGGAGGCGATGGTAAATCGGAGGCACGCGTTTTCGGTCTCCGACATCGATGACAATGGGTCGAT CACCGTCGAGGAGCTGCACAAGGTGATGATCAGCTTGGGAGAAGAGTGCTCGACTGCAGAGTGCTGGAAGATGATCAGTGGGGAGGATCGGGACGACAAC GGTATGATCGATTTCGAGGAGTTTAAGACGATGATGATTCTGGGTTATAGGAGGGGCTCTTCTGAACAGGATGTTGTGAAGCAGTGA
AA sequence Show only first row Show all	>Lus10029660 pacid=23152040 polypeptide=Lus10029660 locus=Lus10029660.g ID=Lus10029660.BGIv1.0 annot-version=v1.0 MIMSSLDHSANDDELQKNDHRVLCQRGRVHRFRRVRGNEHRGVGSEEAMVNRRHAFSVSDIDDNGSITVEELHKVMISLGEECSTAECWKMISGEDRDDN GMIDFEEFKTMMILGYRRGSSEQDVVKQ

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT1G24620			EF hand calcium-binding protei...		Lus10029660 [exp]	0	1
AT2G12400			unknown protein		Lus10039991 [exp]	8.4	0.8107
					Lus10023763 [exp]	12.3	0.7702
AT1G69210			Uncharacterised protein family...		Lus10014566 [exp]	13.1	0.6724
AT5G42290			transcription activator-relate...		Lus10021820 [exp]	18.2	0.7088
AT1G27180			disease resistance protein (TI...		Lus10018309 [exp]	22.4	0.7501
AT5G23510			unknown protein		Lus10029154 [exp]	31.4	0.7060
AT3G29000			Calcium-binding EF-hand family...		Lus10034463 [exp]	34.7	0.7081
AT5G15630		IRX6, COBL4	IRREGULAR XYLEM 6, COBRA-LIKE4...		Lus10021142 [exp]	39.5	0.7039
AT5G36930			Disease resistance protein (TI...		Lus10042714 [exp]	41.3	0.6598
AT1G54860			Glycoprotein membrane precurso...		Lus10004470 [exp]	41.4	0.6942

Compare expression of checked genes

Lus10029660 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.