Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT3G49410 52 / 6e-09 Transcription factor IIIC, subunit 5 (.1) AT5G24450 46 / 1e-06 Transcription factor IIIC, subunit 5 (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10042709 [exp] 130 / 8e-40 AT3G49410 66 / 5e-13 Transcription factor IIIC, subunit 5 (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.017G007200 [exp] 49 / 6e-08 AT5G24450 533 / 0.0 Transcription factor IIIC, subunit 5 (.1)
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10029671 pacid=23151980 polypeptide=Lus10029671 locus=Lus10029671.g ID=Lus10029671.BGIv1.0 annot-version=v1.0 ATGTACTCGTTCTTTGATGATAATTTGGGTGGTAATCAACATGAGACAGCAGACATTCCTATAGATGAACTTGCAGATGATGATGATCAAGAAGAAGAAA TTGATGCATATGATGCTCTAGATTTGGCTGGGGAAGATGACGAGTTCTCACTGCATTCAGATTCATATATGGAAACAGATAGCAACTCAAGAAACTATCT ACAAGAGCTCTTCTATAGCTTCCCAACAACTGAACCTGGAGCTGGCAAAATACATGATGCTGACAGCAGCGATGGCGAATATCAAATACTCGAGCAAGAC GATGAGAATTACTCTGACGATGATTACGAATGA
AA sequence Show only first row Show all	>Lus10029671 pacid=23151980 polypeptide=Lus10029671 locus=Lus10029671.g ID=Lus10029671.BGIv1.0 annot-version=v1.0 MYSFFDDNLGGNQHETADIPIDELADDDDQEEEIDAYDALDLAGEDDEFSLHSDSYMETDSNSRNYLQELFYSFPTTEPGAGKIHDADSSDGEYQILEQD DENYSDDDYE

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT3G49410			Transcription factor IIIC, sub...		Lus10029671 [exp]	0	1
AT3G49410			Transcription factor IIIC, sub...		Lus10042709 [exp]	2.4	0.8404
AT2G22540	MADS	AGL22, SVP	SHORT VEGETATIVE PHASE, AGAMOU...		Lus10035942 [exp]	5.3	0.8432
AT2G28230			TATA-binding related factor (T...		Lus10030654 [exp]	11.1	0.8379
AT5G09250		KIWI	ssDNA-binding transcriptional ...		Lus10013733 [exp]	12.2	0.8249
AT1G13440		GAPC2, GAPC-2	GLYCERALDEHYDE-3-PHOSPHATE DEH...		Lus10022332 [exp]	18.2	0.8371
AT3G52230			unknown protein		Lus10038643 [exp]	19.0	0.8208
AT4G03090			sequence-specific DNA binding;...		Lus10006937 [exp]	25.1	0.8158
					Lus10012945 [exp]	34.5	0.8178
AT1G06980			unknown protein		Lus10006211 [exp]	39.2	0.8162
AT1G04610		YUC3	YUCCA 3 (.1)		Lus10032609 [exp]	42.0	0.8189

Compare expression of checked genes

Lus10029671 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.