Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	No hit found
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10042721 [exp] 160 / 2e-47 AT1G21750 684 / 0.0 ARABIDOPSIS THALIANA PROTEIN DISULFIDE ISOMERASE 5, PDI-like 1-1 (.1.2) Lus10018433 [exp] 154 / 5e-46 AT1G61330 109 / 2e-25 FBD, F-box and Leucine Rich Repeat domains containing protein (.1) Lus10010664 [exp] 136 / 2e-39 AT1G61320 125 / 6e-31 FBD / Leucine Rich Repeat domains containing protein (.1) Lus10034733 [exp] 124 / 1e-34 AT1G61320 110 / 5e-26 FBD / Leucine Rich Repeat domains containing protein (.1) Lus10028334 [exp] 113 / 3e-34 ND / Lus10011971 [exp] 123 / 4e-34 AT1G61320 103 / 2e-23 FBD / Leucine Rich Repeat domains containing protein (.1) Lus10011254 [exp] 103 / 2e-27 AT1G61330 84 / 6e-17 FBD, F-box and Leucine Rich Repeat domains containing protein (.1) Lus10033364 [exp] 66 / 8e-14 AT4G38540 84 / 4e-34 FAD/NAD(P)-binding oxidoreductase family protein (.1) Lus10006726 [exp] 64 / 1e-13 AT1G61330 66 / 1e-12 FBD, F-box and Leucine Rich Repeat domains containing protein (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.011G042900 [exp] 38 / 0.0003 AT1G61330 226 / 2e-68 FBD, F-box and Leucine Rich Repeat domains containing protein (.1) Potri.004G034500 [exp] 38 / 0.0004 AT1G61330 175 / 3e-49 FBD, F-box and Leucine Rich Repeat domains containing protein (.1)
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10029682 pacid=23152085 polypeptide=Lus10029682 locus=Lus10029682.g ID=Lus10029682.BGIv1.0 annot-version=v1.0 ATGGTGGTCCATTGGATAAACAAGGCGTCCCAAAGGGACGTCGAAGAGTTGGAGCTGAATTTCGACCATGACTTAGAGCCGTTCAGGATGACATCCGACC TCATATTTCAGATCAAGACCCTTGAGGCTCTTCATGTGGTGTACATCGATACAGGGTCACCAAACAATGATTTCGTGGTCACCGGGCATAGATTCCTCAA GATCTGCTCGATGGTGAGTATTGAAGTGGTCGTGCTTGATGTCCTGATGAAAAGCTGCACGGAACTCGAGACTCTCGATATCATCAAGTGCTAG
AA sequence Show only first row Show all	>Lus10029682 pacid=23152085 polypeptide=Lus10029682 locus=Lus10029682.g ID=Lus10029682.BGIv1.0 annot-version=v1.0 MVVHWINKASQRDVEELELNFDHDLEPFRMTSDLIFQIKTLEALHVVYIDTGSPNNDFVVTGHRFLKICSMVSIEVVVLDVLMKSCTELETLDIIKC

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
					Lus10029682 [exp]	0	1

Compare expression of checked genes

Lus10029682 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.