Lus10029692 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT1G01720 268 / 8e-90 NAC ATAF1, ANAC002 Arabidopsis NAC domain containing protein 2, NAC (No Apical Meristem) domain transcriptional regulator superfamily protein (.1)
AT1G77450 174 / 1e-53 NAC ANAC032 NAC domain containing protein 32 (.1)
AT5G63790 176 / 2e-53 NAC ANAC102 NAC domain containing protein 102 (.1)
AT5G08790 164 / 4e-49 NAC ATAF2, ANAC081 Arabidopsis NAC domain containing protein 81, NAC (No Apical Meristem) domain transcriptional regulator superfamily protein (.1)
AT4G27410 132 / 6e-37 NAC RD26, ANAC072 NAC (No Apical Meristem) domain transcriptional regulator superfamily protein (.1), NAC (No Apical Meristem) domain transcriptional regulator superfamily protein (.2), NAC (No Apical Meristem) domain transcriptional regulator superfamily protein (.3)
AT3G15500 133 / 7e-37 NAC ATNAC3, ANAC055 NAC domain containing protein 55, NAC domain containing protein 3 (.1)
AT1G52890 132 / 9e-37 NAC ANAC019 NAC domain containing protein 19 (.1)
AT3G04070 132 / 4e-36 NAC ANAC047 NAC domain containing protein 47 (.1.2)
AT3G15510 124 / 3e-33 NAC ATNAC2, ANAC056, NARS1 NAC-REGULATED SEED MORPHOLOGY 1, Arabidopsis NAC domain containing protein 56, NAC domain containing protein 2 (.1)
AT1G61110 120 / 3e-32 NAC ANAC025 NAC domain containing protein 25 (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10042731 442 / 3e-158 AT1G01720 414 / 7e-147 Arabidopsis NAC domain containing protein 2, NAC (No Apical Meristem) domain transcriptional regulator superfamily protein (.1)
Lus10025690 306 / 2e-104 AT1G01720 405 / 1e-143 Arabidopsis NAC domain containing protein 2, NAC (No Apical Meristem) domain transcriptional regulator superfamily protein (.1)
Lus10018142 304 / 1e-103 AT1G01720 401 / 7e-142 Arabidopsis NAC domain containing protein 2, NAC (No Apical Meristem) domain transcriptional regulator superfamily protein (.1)
Lus10020883 176 / 2e-53 AT5G08790 320 / 6e-110 Arabidopsis NAC domain containing protein 81, NAC (No Apical Meristem) domain transcriptional regulator superfamily protein (.1)
Lus10033493 171 / 9e-52 AT5G08790 315 / 4e-108 Arabidopsis NAC domain containing protein 81, NAC (No Apical Meristem) domain transcriptional regulator superfamily protein (.1)
Lus10003848 127 / 7e-37 AT5G08790 145 / 2e-44 Arabidopsis NAC domain containing protein 81, NAC (No Apical Meristem) domain transcriptional regulator superfamily protein (.1)
Lus10003269 133 / 2e-36 AT3G04070 324 / 3e-109 NAC domain containing protein 47 (.1.2)
Lus10006547 132 / 4e-36 AT3G04070 337 / 4e-114 NAC domain containing protein 47 (.1.2)
Lus10011215 129 / 6e-35 AT1G61110 305 / 1e-102 NAC domain containing protein 25 (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.002G081000 278 / 9e-94 AT1G01720 416 / 5e-148 Arabidopsis NAC domain containing protein 2, NAC (No Apical Meristem) domain transcriptional regulator superfamily protein (.1)
Potri.005G180200 259 / 1e-86 AT1G01720 392 / 9e-139 Arabidopsis NAC domain containing protein 2, NAC (No Apical Meristem) domain transcriptional regulator superfamily protein (.1)
Potri.007G099400 234 / 3e-76 AT1G01720 366 / 6e-128 Arabidopsis NAC domain containing protein 2, NAC (No Apical Meristem) domain transcriptional regulator superfamily protein (.1)
Potri.005G069500 231 / 8e-75 AT1G01720 357 / 3e-124 Arabidopsis NAC domain containing protein 2, NAC (No Apical Meristem) domain transcriptional regulator superfamily protein (.1)
Potri.001G404100 139 / 5e-39 AT4G27410 370 / 8e-129 NAC (No Apical Meristem) domain transcriptional regulator superfamily protein (.1), NAC (No Apical Meristem) domain transcriptional regulator superfamily protein (.2), NAC (No Apical Meristem) domain transcriptional regulator superfamily protein (.3)
Potri.011G123300 138 / 2e-38 AT4G27410 354 / 2e-122 NAC (No Apical Meristem) domain transcriptional regulator superfamily protein (.1), NAC (No Apical Meristem) domain transcriptional regulator superfamily protein (.2), NAC (No Apical Meristem) domain transcriptional regulator superfamily protein (.3)
Potri.011G046700 132 / 2e-36 AT1G61110 331 / 8e-113 NAC domain containing protein 25 (.1)
Potri.004G038000 132 / 3e-36 AT1G61110 332 / 3e-113 NAC domain containing protein 25 (.1)
Potri.019G031400 128 / 1e-34 AT3G04070 332 / 1e-112 NAC domain containing protein 47 (.1.2)
Potri.001G404400 127 / 3e-34 AT3G15510 345 / 1e-117 NAC-REGULATED SEED MORPHOLOGY 1, Arabidopsis NAC domain containing protein 56, NAC domain containing protein 2 (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
PF02365 NAM No apical meristem (NAM) protein
Representative CDS sequence
>Lus10029692 pacid=23151954 polypeptide=Lus10029692 locus=Lus10029692.g ID=Lus10029692.BGIv1.0 annot-version=v1.0
ATGGTGTTGGAGTTGCCACCGGGATTCAGGTTCCATCCCACCGACGACGAGCTCGTCAAGCACTACCTTTGCCGGAAGTGCGCCTCCCAACCGATTTCCG
TCCCGATTATTGCCGAAATCGATTTGTATAAGCACGATCCTTGGGATCTCCCAGGTTTGGCTTTGTATGGAGAAAAGGAGTGGTACTTCTTTTCACCGAG
AGACCGGAAGTATCCGAACGGAGAAGCTGCCCGAACGGGCCCCGCCTTAAGCGATCCGCAGCTAGTGGCTATTGGAAGGCTACCGGAGCTGACAAGTCTA
TCGGATCGCCGAGACCAATCGCAATCAAGAAAGCGTTGGTGTTTTACACTGGGAAAGCTCCCAAAGCTTGACGATTGGGTGCTGTGTCGGATTTACAACA
AGAAGGGCGCCGCTGTTGAGAGGCGGACTGCAGGGATACGAAGAGCTGTTTCGCCGGAGACGATAGAGGACATTAAACCGTCGGTGATGGCGGCACCTCC
GCCTCCTCAATTGTCCACCGGAGGTCATCAGACTAACCCGGCCAACAGCGGACGTACATACTTGGAGACGTCAGAGTCGGTGCCGAGGCTGCTTACGGAC
TCAAGCTGCTCGGAGCACGTTTTCTCGCCGGAGTTCACCACGAGCGAGGTGCAGAGCGAGCCGAAATGGCAGGAGTTGGGGACGGCTGGGATCAATGACC
TCGACTATGGGTTTAATTACATGGATGCCACCATGGAGAAGGAATTCGGTTCACAATTCCAGTTCCCTGGCAGTAGTAATCAAATGTCGCCGCTGCAGGA
TATGTTCATGTACCTGCAGCAACCGTTTTGA
AA sequence
>Lus10029692 pacid=23151954 polypeptide=Lus10029692 locus=Lus10029692.g ID=Lus10029692.BGIv1.0 annot-version=v1.0
MVLELPPGFRFHPTDDELVKHYLCRKCASQPISVPIIAEIDLYKHDPWDLPGLALYGEKEWYFFSPRDRKYPNGEAARTGPALSDPQLVAIGRLPELTSL
SDRRDQSQSRKRWCFTLGKLPKLDDWVLCRIYNKKGAAVERRTAGIRRAVSPETIEDIKPSVMAAPPPPQLSTGGHQTNPANSGRTYLETSESVPRLLTD
SSCSEHVFSPEFTTSEVQSEPKWQELGTAGINDLDYGFNYMDATMEKEFGSQFQFPGSSNQMSPLQDMFMYLQQPF

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT1G01720 NAC ATAF1, ANAC002 Arabidopsis NAC domain contain... Lus10029692 0 1
AT2G27690 CYP94C1 "cytochrome P450, family 94, s... Lus10043378 2.0 0.9113
Lus10020461 2.8 0.8946
AT1G19180 ZIM TIFY10A, JAZ1 jasmonate-zim-domain protein 1... Lus10039911 4.5 0.9152
AT1G47890 AtRLP7 receptor like protein 7 (.1) Lus10003387 17.1 0.8778
AT1G10740 alpha/beta-Hydrolases superfam... Lus10029114 17.6 0.8210
AT4G25470 AP2_ERF DREB1C, FTQ4, C... FREEZING TOLERANCE QTL 4, DRE/... Lus10035566 26.4 0.8182
AT5G58950 Protein kinase superfamily pro... Lus10025442 27.7 0.8807
AT4G37710 VQ motif-containing protein (.... Lus10011555 30.9 0.8716
AT5G62750 unknown protein Lus10004267 33.9 0.8525
AT3G62260 Protein phosphatase 2C family ... Lus10038058 38.3 0.8360

Lus10029692 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.