Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT4G17085 86 / 1e-24 Putative membrane lipoprotein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10042735 [exp] 117 / 9e-37 AT4G17085 85 / 4e-24 Putative membrane lipoprotein (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.003G085400 [exp] 75 / 7e-20 AT4G17085 69 / 2e-17 Putative membrane lipoprotein (.1)
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10029696 pacid=23152132 polypeptide=Lus10029696 locus=Lus10029696.g ID=Lus10029696.BGIv1.0 annot-version=v1.0 ATGGGGAAATCCTTCACTTTGGTTCAAACTGTTGCCACTGCAGGAATCTTCTCTGCTGTTTCCGGCTGGTACGGTTTCATGTTCGGTAGAGAATCAGCTC GCAAAGAACTCGGCAGCTTGATCGACGATCTTCGCCGCGGCGGAGATTCCGCCTCCCCTCCTCCTCAGCATTCTTGA
AA sequence Show only first row Show all	>Lus10029696 pacid=23152132 polypeptide=Lus10029696 locus=Lus10029696.g ID=Lus10029696.BGIv1.0 annot-version=v1.0 MGKSFTLVQTVATAGIFSAVSGWYGFMFGRESARKELGSLIDDLRRGGDSASPPPQHS

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT4G17085			Putative membrane lipoprotein ...		Lus10029696 [exp]	0	1
AT1G09010			glycoside hydrolase family 2 p...		Lus10000159 [exp]	5.7	0.8228
AT2G24970			unknown protein		Lus10026900 [exp]	6.9	0.8014
AT3G11730		ATFP8, AtRABD1	ARABIDOPSIS THALIANA RAB GTPAS...		Lus10036442 [exp]	7.9	0.8324
AT1G07950		MED22B	Surfeit locus protein 5 subuni...		Lus10023466 [exp]	10.0	0.8133
AT4G30220		RUXF	small nuclear ribonucleoprotei...		Lus10037606 [exp]	10.7	0.8173
AT4G36740	HD	HB-5, ATHB40	homeobox protein 40 (.1)		Lus10024031 [exp]	12.4	0.7663
AT1G66930			Protein kinase superfamily pro...		Lus10022367 [exp]	12.8	0.8041
AT2G28740		HIS4	histone H4 (.1)		Lus10005448 [exp]	15.6	0.7026
AT1G53590		NTMCTYPE6.1 ,NT...	Calcium-dependent lipid-bindin...		Lus10026192 [exp]	19.1	0.7845
AT2G25180	GARP	ARR12	response regulator 12 (.1)		Lus10005340 [exp]	21.4	0.7872

Compare expression of checked genes

Lus10029696 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.