Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT2G20190 69 / 2e-14 ATCLASP CLIP-associated protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10022838 [exp] 76 / 3e-17 AT2G20190 745 / 0.0 CLIP-associated protein (.1) Lus10011907 [exp] 76 / 3e-17 AT2G20190 2090 / 0.0 CLIP-associated protein (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.002G253200 [exp] 69 / 7e-15 AT2G20190 2103 / 0.0 CLIP-associated protein (.1)
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10029708 pacid=23152013 polypeptide=Lus10029708 locus=Lus10029708.g ID=Lus10029708.BGIv1.0 annot-version=v1.0 ATGCCGTGGAGGAATCCATTGAGAAGCTGCTTCAAGTATCAAAGGATGGTGTACCAAATTAAAGTTTCATTCTTCTGGACATGGTTACTTCCACAGTTAG AGATGCTCAAAGTCGGTCTGCTGCTGCTTGTTTTTCATGTCTTCCGCTCGACTCTTGGAAGCTTTCAACAACGTAACCAGAGTGCCGATGTTCGCAAGAC CGTGGTGGTCTTCTGCCTGGTGGACATATGCATCATGCATGGGAAATCGTTCTTGCCGTACCTGGAAGGGCTCAACAATATGCAGTTGAAGTCGGTCACT ATCTATATATGCGAATCGGATATCGCAGGGCAGAACGGCCAGGCCTAG
AA sequence Show only first row Show all	>Lus10029708 pacid=23152013 polypeptide=Lus10029708 locus=Lus10029708.g ID=Lus10029708.BGIv1.0 annot-version=v1.0 MPWRNPLRSCFKYQRMVYQIKVSFFWTWLLPQLEMLKVGLLLLVFHVFRSTLGSFQQRNQSADVRKTVVVFCLVDICIMHGKSFLPYLEGLNNMQLKSVT IYICESDIAGQNGQA

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT2G20190		ATCLASP	CLIP-associated protein (.1)		Lus10029708 [exp]	0	1
AT1G01050		ATPPA1	pyrophosphorylase 1 (.1)		Lus10030179 [exp]	1.0	0.9168
AT2G33980		ATNUDT22	nudix hydrolase homolog 22 (.1...		Lus10041965 [exp]	1.4	0.8440
AT4G25420		AT2301, GA5, AT...	GA REQUIRING 5, ARABIDOPSIS TH...		Lus10015016 [exp]	4.9	0.8192
AT1G20823			RING/U-box superfamily protein...		Lus10025162 [exp]	22.4	0.7897
					Lus10021894 [exp]	23.5	0.7833
AT1G01050		ATPPA1	pyrophosphorylase 1 (.1)		Lus10005139 [exp]	32.0	0.7249
AT1G77380		AAP3, ATAAP3	amino acid permease 3 (.1)		Lus10042744 [exp]	34.2	0.7414
AT5G62470	MYB	ATMYB96, mybcov...	myb domain protein 96 (.1.2)		Lus10002056 [exp]	40.9	0.7526
					Lus10017869 [exp]	41.9	0.7657
AT1G75800			Pathogenesis-related thaumatin...		Lus10023897 [exp]	46.0	0.7298

Compare expression of checked genes

Lus10029708 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.