Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT2G23120 51 / 7e-10 Late embryogenesis abundant protein, group 6 (.1) AT2G33690 49 / 5e-09 Late embryogenesis abundant protein, group 6 (.1) AT2G23110 49 / 7e-09 Late embryogenesis abundant protein, group 6 (.1.2)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10042745 [exp] 118 / 2e-36 AT2G23110 82 / 3e-22 Late embryogenesis abundant protein, group 6 (.1.2) Lus10016041 [exp] 36 / 0.0003 ND /
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.005G145200 [exp] 75 / 2e-19 AT2G33690 59 / 3e-13 Late embryogenesis abundant protein, group 6 (.1) Potri.002G006000 [exp] 58 / 1e-12 AT2G33690 76 / 1e-19 Late embryogenesis abundant protein, group 6 (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF10714 [flax] [poplar] LEA_6 Late embryogenesis abundant protein 18
Representative CDS sequence Show only first row Show all	>Lus10029709 pacid=23151999 polypeptide=Lus10029709 locus=Lus10029709.g ID=Lus10029709.BGIv1.0 annot-version=v1.0 ATGGAGAAGGAGGCGGAGGTGAAGAAATCTGAAGGTGATCAGGACAAAAAGAAAGTGGAGGAGGGTCTGCCGATGGAGAGCAGTCCATACGTTAACTACG GTAACTTGGAGGACTATAAGCTCAAAGCTTACGGAGCTGAAGGGCATCTCCAGCCCAAACCAGGGCGTGGGGCTGGCTCAACCGATGCTCCCACTCCTTC AGGGGCCACTACTGCCGCCGGAATTACAAGCTCAACCGATACTATTAATCGTCAAGGTGTCCCCTAG
AA sequence Show only first row Show all	>Lus10029709 pacid=23151999 polypeptide=Lus10029709 locus=Lus10029709.g ID=Lus10029709.BGIv1.0 annot-version=v1.0 MEKEAEVKKSEGDQDKKKVEEGLPMESSPYVNYGNLEDYKLKAYGAEGHLQPKPGRGAGSTDAPTPSGATTAAGITSSTDTINRQGVP

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT2G23110			Late embryogenesis abundant pr...		Lus10029709 [exp]	0	1
AT2G23110			Late embryogenesis abundant pr...		Lus10042745 [exp]	1.0	0.9798
AT5G07050			nodulin MtN21 /EamA-like trans...		Lus10041634 [exp]	2.4	0.9439
AT1G49230			RING/U-box superfamily protein...		Lus10006785 [exp]	3.2	0.9137
AT4G16780	HD	ATHB2, HAT4, AT...	ARABIDOPSIS THALIANA HOMEOBOX ...		Lus10040175 [exp]	3.9	0.9353
AT2G16630			Pollen Ole e 1 allergen and ex...		Lus10026279 [exp]	4.2	0.9450
AT1G01580		FRD1, ATFRO2, F...	FERRIC CHELATE REDUCTASE DEFEC...		Lus10039268 [exp]	4.9	0.9227
AT1G01490			Heavy metal transport/detoxifi...		Lus10024670 [exp]	6.5	0.9101
AT3G26510			Octicosapeptide/Phox/Bem1p fam...		Lus10006214 [exp]	8.4	0.9252
AT2G30580		BMI1A, DRIP2	DREB2A-interacting protein 2 (...		Lus10021993 [exp]	8.8	0.8937
AT5G59320		LTP3	lipid transfer protein 3 (.1)		Lus10026418 [exp]	9.5	0.9221

Compare expression of checked genes

Lus10029709 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.