Lus10029710 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT5G10960 147 / 3e-42 Polynucleotidyl transferase, ribonuclease H-like superfamily protein (.1)
AT2G32070 142 / 3e-40 Polynucleotidyl transferase, ribonuclease H-like superfamily protein (.1)
AT1G80780 136 / 4e-38 Polynucleotidyl transferase, ribonuclease H-like superfamily protein (.1.2.3)
AT1G15920 132 / 2e-36 Polynucleotidyl transferase, ribonuclease H-like superfamily protein (.1.2)
AT1G06450 132 / 8e-36 Polynucleotidyl transferase, ribonuclease H-like superfamily protein (.1)
AT1G61470 129 / 3e-35 Polynucleotidyl transferase, ribonuclease H-like superfamily protein (.1)
AT1G27820 129 / 4e-35 Polynucleotidyl transferase, ribonuclease H-like superfamily protein (.1)
AT3G44260 126 / 3e-34 AtCAF1a CCR4- associated factor 1a, Polynucleotidyl transferase, ribonuclease H-like superfamily protein (.1)
AT1G27890 122 / 2e-32 Polynucleotidyl transferase, ribonuclease H-like superfamily protein (.1)
AT5G22250 121 / 2e-32 AtCAF1b CCR4- associated factor 1b, Polynucleotidyl transferase, ribonuclease H-like superfamily protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10042746 557 / 0 AT5G10960 150 / 2e-43 Polynucleotidyl transferase, ribonuclease H-like superfamily protein (.1)
Lus10029713 555 / 0 AT5G10960 144 / 4e-41 Polynucleotidyl transferase, ribonuclease H-like superfamily protein (.1)
Lus10007771 362 / 5e-126 AT1G61470 170 / 5e-51 Polynucleotidyl transferase, ribonuclease H-like superfamily protein (.1)
Lus10000327 228 / 3e-73 AT1G06450 174 / 1e-51 Polynucleotidyl transferase, ribonuclease H-like superfamily protein (.1)
Lus10035078 220 / 5e-70 AT1G06450 168 / 2e-49 Polynucleotidyl transferase, ribonuclease H-like superfamily protein (.1)
Lus10008043 217 / 7e-69 AT1G06450 165 / 5e-48 Polynucleotidyl transferase, ribonuclease H-like superfamily protein (.1)
Lus10001651 211 / 2e-65 AT1G61470 167 / 4e-49 Polynucleotidyl transferase, ribonuclease H-like superfamily protein (.1)
Lus10017905 209 / 2e-65 AT1G06450 162 / 5e-48 Polynucleotidyl transferase, ribonuclease H-like superfamily protein (.1)
Lus10035077 200 / 5e-62 AT1G61470 162 / 6e-48 Polynucleotidyl transferase, ribonuclease H-like superfamily protein (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.018G038700 183 / 8e-56 AT1G61470 182 / 8e-56 Polynucleotidyl transferase, ribonuclease H-like superfamily protein (.1)
Potri.001G046700 159 / 5e-47 AT2G32070 472 / 2e-170 Polynucleotidyl transferase, ribonuclease H-like superfamily protein (.1)
Potri.003G181100 156 / 7e-46 AT1G80780 468 / 1e-168 Polynucleotidyl transferase, ribonuclease H-like superfamily protein (.1.2.3)
Potri.006G262500 155 / 3e-45 AT2G32070 443 / 5e-159 Polynucleotidyl transferase, ribonuclease H-like superfamily protein (.1)
Potri.018G020900 152 / 3e-44 AT2G32070 441 / 2e-158 Polynucleotidyl transferase, ribonuclease H-like superfamily protein (.1)
Potri.004G200400 137 / 2e-38 AT5G22250 419 / 3e-149 CCR4- associated factor 1b, Polynucleotidyl transferase, ribonuclease H-like superfamily protein (.1)
Potri.006G187200 134 / 3e-37 AT2G32070 403 / 2e-143 Polynucleotidyl transferase, ribonuclease H-like superfamily protein (.1)
Potri.009G161500 132 / 1e-36 AT5G22250 387 / 1e-136 CCR4- associated factor 1b, Polynucleotidyl transferase, ribonuclease H-like superfamily protein (.1)
Potri.001G040400 120 / 4e-32 AT5G22250 253 / 4e-84 CCR4- associated factor 1b, Polynucleotidyl transferase, ribonuclease H-like superfamily protein (.1)
Potri.006G205600 120 / 9e-32 AT5G22250 302 / 4e-103 CCR4- associated factor 1b, Polynucleotidyl transferase, ribonuclease H-like superfamily protein (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0219 RNase_H PF04857 CAF1 CAF1 family ribonuclease
Representative CDS sequence
>Lus10029710 pacid=23151969 polypeptide=Lus10029710 locus=Lus10029710.g ID=Lus10029710.BGIv1.0 annot-version=v1.0
ATGGTTACATACGTTCGACAAGTGTGGGATTCGGATCTCCGGCGAGAGCTTGCAGTTCTGGAACAGGCGCTTCCAAAGTACCCAGTACTCAGTGTGGATT
GCGATGGATTCCTGCTCAAAACACCAAGAAACCCTACTGGCGATCTTTGGTATAGCGATCTCAAACACAAAGTCGACCAAACCCACATCACCCAACTCAG
CGTCGCTCTTTCCGACCACGGCGGAACCGTCTTCTGCACCTGGAAGTTCAATTTTGAGTTTGATGTTGACGAAGATGTTCACACCAAAGACACGGTCGCA
TTTCTGAAGGGTCAGGGAATTGATTTCCAAAAGCATAGAGCGGATGGCATCAAAAGGACTCGATTTGGTGCCCAATTCTGCAACTTGATGGCGAGCAAAA
CCACTCCTCTGACATGGGTCACCTTCCATGGGTTGTATGATTTTGCTCACATCCTCAAGGTGCTTACCAACAACACACCCATGCCTGACACGCCTTCTGG
CTTTAGAGACTTGTTGGGATATTCTTTTGAGGAGATTGTCGATCTCAAGGTGATGGCCAAGTTTTGCGATGGAATTTCTGATATGGAGGAGGTTGGGTTG
CAGAAACTGGCAGATTTGCTGAGCATCAAGAGAGAGGATGGTGAAGCTTTACATGAAGCTGGTTCTGACAGTTTACTCACTGCAATGGTGTTTTCCAACA
TGAGAAGAAGAGTCCAAGATGATCAACATGATGTATATACTGATTATCTCTTTGGAATCACTGAAAGGATTGGAAGAAGCCCTGCCATTCAGGTTCGCTT
CTCCCACCGATGGTTGTGCCAGCCGCTGCTGCCATTGCACGTTCCATGCTATCGTCGTTATCGTCCTTATCCTCGTCCTCCTCGTCGATGTCTTCTTCTT
CCCCTGCATCCCCCTACAAGAATGGGTCAGTACTGA
AA sequence
>Lus10029710 pacid=23151969 polypeptide=Lus10029710 locus=Lus10029710.g ID=Lus10029710.BGIv1.0 annot-version=v1.0
MVTYVRQVWDSDLRRELAVLEQALPKYPVLSVDCDGFLLKTPRNPTGDLWYSDLKHKVDQTHITQLSVALSDHGGTVFCTWKFNFEFDVDEDVHTKDTVA
FLKGQGIDFQKHRADGIKRTRFGAQFCNLMASKTTPLTWVTFHGLYDFAHILKVLTNNTPMPDTPSGFRDLLGYSFEEIVDLKVMAKFCDGISDMEEVGL
QKLADLLSIKREDGEALHEAGSDSLLTAMVFSNMRRRVQDDQHDVYTDYLFGITERIGRSPAIQVRFSHRWLCQPLLPLHVPCYRRYRPYPRPPRRCLLL
PLHPPTRMGQY

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT5G10960 Polynucleotidyl transferase, r... Lus10029710 0 1
AT5G10960 Polynucleotidyl transferase, r... Lus10029713 1.4 0.7928
AT5G10960 Polynucleotidyl transferase, r... Lus10042746 2.2 0.8291
AT2G26270 unknown protein Lus10038079 13.0 0.6977
AT5G06740 Concanavalin A-like lectin pro... Lus10036986 13.0 0.6890
AT5G51990 AP2_ERF CBF4, DREB1D DEHYDRATION-RESPONSIVE ELEMENT... Lus10031657 14.8 0.7244
Lus10025700 15.7 0.7298
AT4G39680 SAP domain-containing protein ... Lus10016433 16.0 0.7243
AT5G48720 XRI1, XRI x-ray induced transcript 1 (.1... Lus10038181 18.5 0.7140
AT1G53025 Ubiquitin-conjugating enzyme f... Lus10028151 31.9 0.7050
AT4G24290 MAC/Perforin domain-containing... Lus10037363 41.0 0.6632

Lus10029710 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.