Lus10029713 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT1G80780 144 / 5e-41 Polynucleotidyl transferase, ribonuclease H-like superfamily protein (.1.2.3)
AT5G10960 144 / 6e-41 Polynucleotidyl transferase, ribonuclease H-like superfamily protein (.1)
AT2G32070 141 / 5e-40 Polynucleotidyl transferase, ribonuclease H-like superfamily protein (.1)
AT1G06450 137 / 1e-37 Polynucleotidyl transferase, ribonuclease H-like superfamily protein (.1)
AT1G61470 132 / 2e-36 Polynucleotidyl transferase, ribonuclease H-like superfamily protein (.1)
AT1G27820 131 / 6e-36 Polynucleotidyl transferase, ribonuclease H-like superfamily protein (.1)
AT1G15920 131 / 6e-36 Polynucleotidyl transferase, ribonuclease H-like superfamily protein (.1.2)
AT3G44260 127 / 1e-34 AtCAF1a CCR4- associated factor 1a, Polynucleotidyl transferase, ribonuclease H-like superfamily protein (.1)
AT1G27890 124 / 3e-33 Polynucleotidyl transferase, ribonuclease H-like superfamily protein (.1)
AT5G22250 121 / 2e-32 AtCAF1b CCR4- associated factor 1b, Polynucleotidyl transferase, ribonuclease H-like superfamily protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10029710 544 / 0 AT5G10960 147 / 2e-42 Polynucleotidyl transferase, ribonuclease H-like superfamily protein (.1)
Lus10042746 533 / 0 AT5G10960 150 / 2e-43 Polynucleotidyl transferase, ribonuclease H-like superfamily protein (.1)
Lus10007771 360 / 6e-125 AT1G61470 170 / 5e-51 Polynucleotidyl transferase, ribonuclease H-like superfamily protein (.1)
Lus10000327 230 / 5e-74 AT1G06450 174 / 1e-51 Polynucleotidyl transferase, ribonuclease H-like superfamily protein (.1)
Lus10035078 223 / 5e-71 AT1G06450 168 / 2e-49 Polynucleotidyl transferase, ribonuclease H-like superfamily protein (.1)
Lus10008043 219 / 2e-69 AT1G06450 165 / 5e-48 Polynucleotidyl transferase, ribonuclease H-like superfamily protein (.1)
Lus10001651 213 / 3e-66 AT1G61470 167 / 4e-49 Polynucleotidyl transferase, ribonuclease H-like superfamily protein (.1)
Lus10017905 211 / 3e-66 AT1G06450 162 / 5e-48 Polynucleotidyl transferase, ribonuclease H-like superfamily protein (.1)
Lus10035077 201 / 1e-62 AT1G61470 162 / 6e-48 Polynucleotidyl transferase, ribonuclease H-like superfamily protein (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.018G038700 179 / 3e-54 AT1G61470 182 / 8e-56 Polynucleotidyl transferase, ribonuclease H-like superfamily protein (.1)
Potri.001G046700 154 / 5e-45 AT2G32070 472 / 2e-170 Polynucleotidyl transferase, ribonuclease H-like superfamily protein (.1)
Potri.003G181100 151 / 7e-44 AT1G80780 468 / 1e-168 Polynucleotidyl transferase, ribonuclease H-like superfamily protein (.1.2.3)
Potri.006G262500 150 / 2e-43 AT2G32070 443 / 5e-159 Polynucleotidyl transferase, ribonuclease H-like superfamily protein (.1)
Potri.018G020900 147 / 2e-42 AT2G32070 441 / 2e-158 Polynucleotidyl transferase, ribonuclease H-like superfamily protein (.1)
Potri.004G200400 136 / 3e-38 AT5G22250 419 / 3e-149 CCR4- associated factor 1b, Polynucleotidyl transferase, ribonuclease H-like superfamily protein (.1)
Potri.006G187200 132 / 1e-36 AT2G32070 403 / 2e-143 Polynucleotidyl transferase, ribonuclease H-like superfamily protein (.1)
Potri.009G161500 132 / 2e-36 AT5G22250 387 / 1e-136 CCR4- associated factor 1b, Polynucleotidyl transferase, ribonuclease H-like superfamily protein (.1)
Potri.001G040400 122 / 9e-33 AT5G22250 253 / 4e-84 CCR4- associated factor 1b, Polynucleotidyl transferase, ribonuclease H-like superfamily protein (.1)
Potri.006G205600 119 / 2e-31 AT5G22250 302 / 4e-103 CCR4- associated factor 1b, Polynucleotidyl transferase, ribonuclease H-like superfamily protein (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0219 RNase_H PF04857 CAF1 CAF1 family ribonuclease
Representative CDS sequence
>Lus10029713 pacid=23152073 polypeptide=Lus10029713 locus=Lus10029713.g ID=Lus10029713.BGIv1.0 annot-version=v1.0
ATGGTTACATACGTTCGACAAGTGTGGGATTCGGATCTCCGGCGAGAGCTTGCAGTTCTGGAACAGGCGCTTCCAAAGTACCCAGTACTCAGTGTGGATT
GCGATGGATTCCTGCTCAAAACACCAAGAACCCCTACTGGCGATCTTTGGTATAGCGATCTCAGACTCACCGTCGACCAAACCCACATCATGCAACTCGG
CGTCACTCTCTCCAACCACGGAGGAACCGTCTTCTCAACCTGGAAGTTCAACTTTGAGTTGGATGTTGACGAAGATGTTCACACCAAAGACACGGTCGCA
TTTCTGAAGGGTCAGGGAATTGATTTCCAAAAGCATAGAGCGGATGGCATCAAAAGGACTCGATTTGGTGCCCAATTCTGCAACTTGATGGCGAGCAAAA
CCACTCCTCTGACATGGGTCACCTTCCATGGGTTGTATGATTTTGCTCACATCCTCAAGGTGCTTACCAACAACACACCCATGCCTGACACGCCTTCTGG
CTTTAGAGACTTGTTGGGATATTCTTTTGAGGAGATTGTCGATCTCAAGGTGATGGCCAAGTTTTGCGATGGAATTTCTGATATGGAGGAGGTTGGGTTG
CAGAAACTGGCAGATTTGCTGAGCATCAAGAGGGAGGATGGTGAAGCTTTACATGAAGCTGGTTCTGACAGTTTACTCACTGCAATGGTGTTTTCCAACA
TGAGAAGAAGATTCCAAGATGATCAACATCATGTATATACTGATTATCTCTTTGGAATCACTGAAAGGATTGGAAGAAGCCCTGCCATTCAGGTTCGCTA
CTCCCACCGATGGTTGTGCCAGCCGCTGCTCCCATTGCGCGTTCCATGCTATCGTCGTTATCGTCCTTATCCTCGTCCTCCTCGTCGATGTCTTCTTCTT
CCCCTGCATACCTCTACAGGAATGGGTCAGTACTGA
AA sequence
>Lus10029713 pacid=23152073 polypeptide=Lus10029713 locus=Lus10029713.g ID=Lus10029713.BGIv1.0 annot-version=v1.0
MVTYVRQVWDSDLRRELAVLEQALPKYPVLSVDCDGFLLKTPRTPTGDLWYSDLRLTVDQTHIMQLGVTLSNHGGTVFSTWKFNFELDVDEDVHTKDTVA
FLKGQGIDFQKHRADGIKRTRFGAQFCNLMASKTTPLTWVTFHGLYDFAHILKVLTNNTPMPDTPSGFRDLLGYSFEEIVDLKVMAKFCDGISDMEEVGL
QKLADLLSIKREDGEALHEAGSDSLLTAMVFSNMRRRFQDDQHHVYTDYLFGITERIGRSPAIQVRYSHRWLCQPLLPLRVPCYRRYRPYPRPPRRCLLL
PLHTSTGMGQY

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT5G10960 Polynucleotidyl transferase, r... Lus10029713 0 1
AT5G10960 Polynucleotidyl transferase, r... Lus10029710 1.4 0.7928
Lus10019295 1.4 0.7002
AT5G48720 XRI1, XRI x-ray induced transcript 1 (.1... Lus10038181 15.3 0.6949
AT3G09150 ATHY2, GUN3, HY... GENOMES UNCOUPLED 3, ARABIDOPS... Lus10022422 21.9 0.5814
AT4G08170 Inositol 1,3,4-trisphosphate 5... Lus10007689 33.9 0.5518
AT1G48650 DEA(D/H)-box RNA helicase fami... Lus10009643 48.1 0.5938
AT1G05280 Protein of unknown function (D... Lus10027153 56.5 0.5584
AT1G06240 Protein of unknown function DU... Lus10017666 57.0 0.5935
AT1G02010 SEC1A secretory 1A (.1.2) Lus10015870 91.0 0.5471
AT2G18660 AtPNP-A, PNP-A,... plant natriuretic peptide A (.... Lus10026929 142.9 0.5007

Lus10029713 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.