Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT4G33260 182 / 2e-56 AtCDC20.2, CDC20.2 cell division cycle 20.2, Transducin family protein / WD-40 repeat family protein (.1.2) AT4G33270 182 / 2e-56 AtCDC20.1, CDC20.1 cell division cycle 20.1, Transducin family protein / WD-40 repeat family protein (.1) AT5G27570 172 / 6e-53 AtCDC20.5 cell division cycle 20.5, Transducin/WD40 repeat-like superfamily protein (.1) AT5G27945 169 / 1e-51 Transducin/WD40 repeat-like superfamily protein (.1) AT5G26900 166 / 3e-50 AtCDC20.4 cell division cycle 20.4, Transducin family protein / WD-40 repeat family protein (.1) AT5G27080 166 / 8e-50 AtCDC20.3 cell division cycle 20.3, Transducin family protein / WD-40 repeat family protein (.1) AT5G13840 133 / 2e-37 FZR3 FIZZY-related 3 (.1.2) AT4G11920 131 / 8e-37 FZR1, CCS52A2 FIZZY-RELATED 1, cell cycle switch protein 52 A2 (.1) AT4G22910 130 / 3e-36 CCS52A1, FZR2 cell cycle switch protein 52 A1, FIZZY-related 2 (.1) AT5G52820 47 / 2e-06 WD-40 repeat family protein / notchless protein, putative (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10042765 [exp] 227 / 2e-74 AT4G33270 542 / 0.0 cell division cycle 20.1, Transducin family protein / WD-40 repeat family protein (.1) Lus10042748 [exp] 225 / 1e-69 AT4G33270 592 / 0.0 cell division cycle 20.1, Transducin family protein / WD-40 repeat family protein (.1) Lus10037595 [exp] 194 / 2e-63 AT4G33270 402 / 2e-141 cell division cycle 20.1, Transducin family protein / WD-40 repeat family protein (.1) Lus10011833 [exp] 189 / 2e-61 AT4G33270 255 / 4e-83 cell division cycle 20.1, Transducin family protein / WD-40 repeat family protein (.1) Lus10037593 [exp] 193 / 1e-60 AT4G33270 728 / 0.0 cell division cycle 20.1, Transducin family protein / WD-40 repeat family protein (.1) Lus10034687 [exp] 191 / 1e-59 AT4G33270 620 / 0.0 cell division cycle 20.1, Transducin family protein / WD-40 repeat family protein (.1) Lus10006851 [exp] 189 / 4e-59 AT4G33270 728 / 0.0 cell division cycle 20.1, Transducin family protein / WD-40 repeat family protein (.1) Lus10006853 [exp] 191 / 3e-57 AT4G33270 729 / 0.0 cell division cycle 20.1, Transducin family protein / WD-40 repeat family protein (.1) Lus10025838 [exp] 151 / 9e-47 AT4G33270 295 / 3e-99 cell division cycle 20.1, Transducin family protein / WD-40 repeat family protein (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.016G118400 [exp] 182 / 3e-56 AT4G33270 771 / 0.0 cell division cycle 20.1, Transducin family protein / WD-40 repeat family protein (.1) Potri.013G048900 [exp] 179 / 3e-55 AT4G33270 766 / 0.0 cell division cycle 20.1, Transducin family protein / WD-40 repeat family protein (.1) Potri.019G021800 [exp] 179 / 3e-55 AT4G33270 767 / 0.0 cell division cycle 20.1, Transducin family protein / WD-40 repeat family protein (.1) Potri.016G068700 [exp] 169 / 2e-51 AT4G33270 607 / 0.0 cell division cycle 20.1, Transducin family protein / WD-40 repeat family protein (.1) Potri.001G112700 [exp] 130 / 2e-36 AT4G22910 705 / 0.0 cell cycle switch protein 52 A1, FIZZY-related 2 (.1) Potri.003G119500 [exp] 129 / 8e-36 AT4G22910 702 / 0.0 cell cycle switch protein 52 A1, FIZZY-related 2 (.1) Potri.010G202100 [exp] 128 / 1e-35 AT5G13840 707 / 0.0 FIZZY-related 3 (.1.2) Potri.008G057500 [exp] 128 / 2e-35 AT5G13840 705 / 0.0 FIZZY-related 3 (.1.2) Potri.015G110300 [exp] 116 / 3e-31 AT4G33270 363 / 5e-122 cell division cycle 20.1, Transducin family protein / WD-40 repeat family protein (.1) Potri.009G058000 [exp] 50 / 1e-07 AT5G52820 811 / 0.0 WD-40 repeat family protein / notchless protein, putative (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0186 [flax] [poplar] Beta_propeller PF00400 [flax] [poplar] WD40 WD domain, G-beta repeat
Representative CDS sequence Show only first row Show all	>Lus10029716 pacid=23152115 polypeptide=Lus10029716 locus=Lus10029716.g ID=Lus10029716.BGIv1.0 annot-version=v1.0 ATGGAGGCTCGCCAAAGACTCGTCGGACGGTCATCAGAGACTTGCCGAGAGTCTCACCGATGGCAGACTCTTGCCAAAGGAGGCGGCGGAGAAGACAGGA CGGTCAAGTTCTGGAACACCACCACGGGTGCGTGCTTGAACTCGGTGAACACGGGCTCTCCAGTTTGTGCATTGCTGTGGAACAAGAACGAGAGGGAACT CTTAAGCTCTCATGGGTTCCCCGGGAATCAGCTTACCTTGTGGAAGTATCCACCCATGTTGAAGATCGTAGAGCTTACTGGCCATACTTCCAGTGTCCTT TTCATGGCTCAGAGCCCAGATGGATGCACGGTGGCATCCGCTGCAGGGGATCAAACTCTGAGGGTCTGGTACGTGTTTGGTGATCCTAAAGCTGCTGCTG CTGCGAAGAAGAAAGCGAATCAGGACTCTTGGGCGAATCGGAACCGGTGCACCATCCGGTGA
AA sequence Show only first row Show all	>Lus10029716 pacid=23152115 polypeptide=Lus10029716 locus=Lus10029716.g ID=Lus10029716.BGIv1.0 annot-version=v1.0 MEARQRLVGRSSETCRESHRWQTLAKGGGGEDRTVKFWNTTTGACLNSVNTGSPVCALLWNKNERELLSSHGFPGNQLTLWKYPPMLKIVELTGHTSSVL FMAQSPDGCTVASAAGDQTLRVWYVFGDPKAAAAAKKKANQDSWANRNRCTIR

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT4G33270		AtCDC20.1, CDC2...	cell division cycle 20.1, Tran...		Lus10029716 [exp]	0	1
AT5G17670			alpha/beta-Hydrolases superfam...		Lus10005666 [exp]	3.2	0.9291
AT5G16010			3-oxo-5-alpha-steroid 4-dehydr...		Lus10028869 [exp]	3.5	0.8967
AT4G39970			Haloacid dehalogenase-like hyd...		Lus10000633 [exp]	4.7	0.9293
AT2G20830			transferases;folic acid bindin...		Lus10018558 [exp]	5.3	0.8906
AT1G73060		LPA3	Low PSII Accumulation 3 (.1)		Lus10026089 [exp]	8.1	0.9205
AT5G35970			P-loop containing nucleoside t...		Lus10024974 [exp]	11.0	0.9061
AT5G19940			Plastid-lipid associated prote...		Lus10026221 [exp]	11.3	0.9148
AT2G30950		FTSH2, VAR2	VARIEGATED 2, FtsH extracellul...		Lus10001054 [exp]	16.0	0.9064
AT4G35250			NAD(P)-binding Rossmann-fold s...		Lus10022632 [exp]	18.1	0.9053
AT3G11670		DGD1	DIGALACTOSYL DIACYLGLYCEROL DE...		Lus10013576 [exp]	18.9	0.8162

Compare expression of checked genes

Lus10029716 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.