Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT3G57120 70 / 3e-14 Protein kinase superfamily protein (.1) AT2G33580 59 / 4e-10 Protein kinase superfamily protein (.1) AT3G21630 56 / 2e-09 LYSMRLK1, CERK1 LYSM DOMAIN RECEPTOR-LIKE KINASE 1, chitin elicitor receptor kinase 1 (.1) AT2G02800 56 / 3e-09 Kin2, APK2B protein kinase 2B (.1.2) AT1G29730 55 / 5e-09 Leucine-rich repeat transmembrane protein kinase (.1) AT1G14370 54 / 2e-08 Kin1, PBL2, APK2A PBS1-like 2, kinase 1, protein kinase 2A (.1) AT2G18890 53 / 2e-08 Protein kinase superfamily protein (.1.2) AT4G21390 52 / 5e-08 B120 S-locus lectin protein kinase family protein (.1) AT1G09970 52 / 1e-07 RLK7, LRRXI-23 ,LRR XI-23 receptor-like kinase 7, Leucine-rich receptor-like protein kinase family protein (.1.2) AT5G38560 51 / 1e-07 AtPERK8 proline-rich extensin-like receptor kinase 8, Protein kinase superfamily protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10038716 [exp] 60 / 1e-10 AT3G57120 407 / 1e-138 Protein kinase superfamily protein (.1) Lus10021451 [exp] 59 / 1e-10 AT3G57120 259 / 4e-85 Protein kinase superfamily protein (.1) Lus10006746 [exp] 57 / 1e-09 AT1G11340 836 / 0.0 S-locus lectin protein kinase family protein (.1) Lus10016113 [exp] 56 / 4e-09 AT3G57120 447 / 8e-154 Protein kinase superfamily protein (.1) Lus10006745 [exp] 56 / 5e-09 AT1G11340 774 / 0.0 S-locus lectin protein kinase family protein (.1) Lus10037586 [exp] 55 / 1e-08 AT1G51940 807 / 0.0 protein kinase family protein / peptidoglycan-binding LysM domain-containing protein (.1) Lus10006841 [exp] 54 / 2e-08 AT1G51940 812 / 0.0 protein kinase family protein / peptidoglycan-binding LysM domain-containing protein (.1) Lus10013223 [exp] 53 / 2e-08 AT1G76360 400 / 8e-139 Protein kinase superfamily protein (.1) Lus10020080 [exp] 53 / 4e-08 AT4G21390 730 / 0.0 S-locus lectin protein kinase family protein (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.008G037501 [exp] 65 / 2e-12 AT3G57120 411 / 3e-141 Protein kinase superfamily protein (.1) Potri.008G037401 [exp] 64 / 4e-12 AT3G57120 371 / 2e-125 Protein kinase superfamily protein (.1) Potri.010G224900 [exp] 61 / 4e-11 AT3G57120 414 / 2e-142 Protein kinase superfamily protein (.1) Potri.009G009600 [exp] 61 / 7e-11 AT3G57120 444 / 6e-154 Protein kinase superfamily protein (.1) Potri.017G036300 [exp] 60 / 1e-10 AT3G59350 632 / 0.0 Protein kinase superfamily protein (.1.2.3) Potri.011G030650 [exp] 55 / 5e-09 AT4G05200 476 / 1e-159 cysteine-rich RLK (RECEPTOR-like protein kinase) 25 (.1) Potri.008G148000 [exp] 54 / 2e-08 AT2G02800 604 / 0.0 protein kinase 2B (.1.2) Potri.011G037600 [exp] 54 / 2e-08 AT4G21390 899 / 0.0 S-locus lectin protein kinase family protein (.1) Potri.004G027800 [exp] 53 / 2e-08 AT4G21390 941 / 0.0 S-locus lectin protein kinase family protein (.1) Potri.010G093700 [exp] 53 / 2e-08 AT2G02800 627 / 0.0 protein kinase 2B (.1.2)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0016 [flax] [poplar] PKinase PF00069 [flax] [poplar] Pkinase Protein kinase domain
Representative CDS sequence Show only first row Show all	>Lus10029721 pacid=23152046 polypeptide=Lus10029721 locus=Lus10029721.g ID=Lus10029721.BGIv1.0 annot-version=v1.0 ATGGATGTCGAGAATGGAGATCGCACTGGGGGTGGCTCGTGGACTACACTACATCCACCACTGCACAGGATTCGATGTCGTCTTCATTACACCCATATCA AAAGCTCCAACGTCATCCTCAACCGTACTTCTCAACAAACCAAAGCCATGATATGCAATTTTGGCCTTGCACATGCTAATGGGCAGGCGGCTAATGGCTT ACGAGACAACGAGCAATACGATGGGTACTTGGCACCTGAGACTCGTTGGCAAGGGATAGTGACACAGGAGTCGGATAGTGTATGCATTCGGGTATTGCTG TTAGAGCTGCTTCCGGGTAAGGATCCTTTGAAGTATAATATCGTAGCAACGGCGAAGGAAATATTCTTAGGCGGGGACGAGGTACGCAAAATAGATGAGG AGGTGAGGAATTTGATGGATAAGAGGCTGGGTAACTTCATCCCTCTCAAGATTGCGAGAAATGCAATACGGGTAACCCTGCTTTGCGTCAGTGATGATCA CAGTTTGCGCCCAAACATGAGCTTTGTATTAGAAAGTCCAACGACATTACTTACTACAGTTGGCCCAATTGAATGA
AA sequence Show only first row Show all	>Lus10029721 pacid=23152046 polypeptide=Lus10029721 locus=Lus10029721.g ID=Lus10029721.BGIv1.0 annot-version=v1.0 MDVENGDRTGGGSWTTLHPPLHRIRCRLHYTHIKSSNVILNRTSQQTKAMICNFGLAHANGQAANGLRDNEQYDGYLAPETRWQGIVTQESDSVCIRVLL LELLPGKDPLKYNIVATAKEIFLGGDEVRKIDEEVRNLMDKRLGNFIPLKIARNAIRVTLLCVSDDHSLRPNMSFVLESPTTLLTTVGPIE

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT3G57120			Protein kinase superfamily pro...		Lus10029721 [exp]	0	1
AT3G44480		COG1, RPP10, RP...	recognition of peronospora par...		Lus10005813 [exp]	1.0	0.9303
AT1G01490			Heavy metal transport/detoxifi...		Lus10027522 [exp]	2.4	0.9080
AT5G40010		ASD, AATP1	ATPase-in-Seed-Development, AA...		Lus10015354 [exp]	2.8	0.9177
AT5G05190			Protein of unknown function (D...		Lus10029013 [exp]	3.2	0.8684
AT1G76360			Protein kinase superfamily pro...		Lus10030742 [exp]	4.0	0.9001
					Lus10042751 [exp]	4.9	0.8825
AT2G22330		CYP79B3	"cytochrome P450, family 79, s...		Lus10000239 [exp]	5.3	0.8785
AT4G15690			Thioredoxin superfamily protei...		Lus10002887 [exp]	9.7	0.8899
AT3G56400	WRKY	ATWRKY70, WRKY7...	ARABIDOPSIS THALIANA WRKY DNA-...		Lus10025216 [exp]	9.9	0.8600
AT3G57120			Protein kinase superfamily pro...		Lus10011518 [exp]	12.0	0.8667

Compare expression of checked genes

Lus10029721 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.