Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	No hit found
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10042766 [exp] 108 / 7e-33 ND /
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.005G184450 [exp] 69 / 2e-17 ND / Potri.002G075850 [exp] 69 / 3e-17 ND /
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10029735 pacid=23152080 polypeptide=Lus10029735 locus=Lus10029735.g ID=Lus10029735.BGIv1.0 annot-version=v1.0 ATGATGTTGGTTACTTGGAAGCAAAAGCACTGCATTGTTCTTGTGTTGGCTCTTTTGGTGGTGGTGTCAGAGTCAGCAAGATTGCCAGACTGGGAACAAA TGCTGCCAAAGAAGCTTCCAAGACCTTATTCAGCACCTTCCAAGGGTACAAACTCCATCACTGTTTCTTCTTCTTCTACAGATAGATTTCTTCCTTCTTC TGATGGCAAAGTGTAG
AA sequence Show only first row Show all	>Lus10029735 pacid=23152080 polypeptide=Lus10029735 locus=Lus10029735.g ID=Lus10029735.BGIv1.0 annot-version=v1.0 MMLVTWKQKHCIVLVLALLVVVSESARLPDWEQMLPKKLPRPYSAPSKGTNSITVSSSSTDRFLPSSDGKV

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
					Lus10029735 [exp]	0	1
					Lus10018556 [exp]	13.1	0.8827
AT5G48130			Phototropic-responsive NPH3 fa...		Lus10001164 [exp]	14.1	0.8662
AT5G57620	MYB	ATMYB36	myb domain protein 36 (.1)		Lus10007248 [exp]	14.6	0.8918
AT5G57620	MYB	ATMYB36	myb domain protein 36 (.1)		Lus10006978 [exp]	21.7	0.8765
					Lus10042766 [exp]	35.3	0.8603
AT3G11550		CASP2	Casparian strip membrane domai...		Lus10021333 [exp]	48.4	0.8721
AT5G57620	MYB	ATMYB36	myb domain protein 36 (.1)		Lus10001316 [exp]	62.1	0.8647
AT4G35783		RTFL6, DVL17	DEVIL 17, ROTUNDIFOLIA like 6 ...		Lus10041846 [exp]	70.0	0.8285
AT3G01980			NAD(P)-binding Rossmann-fold s...		Lus10041545 [exp]	73.5	0.8520
AT4G32140			EamA-like transporter family (...		Lus10006194 [exp]	82.9	0.8572

Compare expression of checked genes

Lus10029735 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.