Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	No hit found
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10042785 [exp] 107 / 6e-29 AT1G43850 721 / 0.0 SEUSS transcriptional co-regulator (.1.2) Lus10029756 [exp] 103 / 2e-27 AT1G43850 721 / 0.0 SEUSS transcriptional co-regulator (.1.2) Lus10018933 [exp] 66 / 3e-14 AT1G43850 435 / 1e-143 SEUSS transcriptional co-regulator (.1.2) Lus10028635 [exp] 53 / 9e-10 AT1G43850 518 / 5e-174 SEUSS transcriptional co-regulator (.1.2)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.002G072900 [exp] 77 / 4e-18 AT1G43850 569 / 0.0 SEUSS transcriptional co-regulator (.1.2) Potri.005G186900 [exp] 76 / 4e-18 AT1G43850 612 / 0.0 SEUSS transcriptional co-regulator (.1.2)
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10029753 pacid=23152091 polypeptide=Lus10029753 locus=Lus10029753.g ID=Lus10029753.BGIv1.0 annot-version=v1.0 ATGGGTGGAGTTGGGCAGCAGTCTGCAATGACTAATGGAATGAGAGCTGCAATGGGGAATAACTCCTTCATGAATGGAAGGATGGCTATGGCATCAATGG TGAGAGAACAAGCGATGAACAGCCAACAACAGGATTTGAGTAACCAGTTACTTAGTGGGTTAGGAGCAGTGAATGGATTTAATAATCTGCAGTTTGATTG GAAACCATCTCCTTGA
AA sequence Show only first row Show all	>Lus10029753 pacid=23152091 polypeptide=Lus10029753 locus=Lus10029753.g ID=Lus10029753.BGIv1.0 annot-version=v1.0 MGGVGQQSAMTNGMRAAMGNNSFMNGRMAMASMVREQAMNSQQQDLSNQLLSGLGAVNGFNNLQFDWKPSP

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT1G43850		SEU	SEUSS transcriptional co-regul...		Lus10029753 [exp]	0	1
AT3G60480			unknown protein		Lus10034728 [exp]	1.0	0.8200
					Lus10036648 [exp]	3.5	0.7848
AT3G06050		PRXIIF, ATPRXII...	peroxiredoxin IIF (.1)		Lus10041218 [exp]	3.5	0.8155
AT2G14750		APK1, ATAKN1, A...	ADENOSINE-5'-PHOSPHOSULFATE \(...		Lus10033788 [exp]	4.0	0.8032
AT1G64810		APO1	ACCUMULATION OF PHOTOSYSTEM ON...		Lus10039122 [exp]	5.8	0.8199
AT4G25270		OTP70	organelle transcript processin...		Lus10031714 [exp]	6.6	0.8154
AT1G55805			BolA-like family protein (.1)		Lus10002318 [exp]	8.1	0.8093
AT1G55520		ATTBP2, TBP2	A. THALIANA TATA BINDING PROTE...		Lus10002634 [exp]	10.6	0.7812
AT3G26000			Ribonuclease inhibitor (.1)		Lus10006438 [exp]	11.5	0.8064
AT5G41620			unknown protein		Lus10003027 [exp]	13.8	0.7396

Compare expression of checked genes

Lus10029753 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.