Plant FIBer expression Database

Lus10029762 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT4G15733 59 / 2e-13 SCRL11 SCR-like 11 (.1)
AT4G22115 52 / 2e-10 SCRL14 SCR-like 14 (.1)
AT4G15735 51 / 4e-10 SCRL10 SCR-like 10 (.1)
AT4G22105 42 / 8e-07 SCRL26 SCR-like 26 (.1)
AT2G05117 40 / 4e-06 SCRL9 SCR-like 9 (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10042791
[exp]
129 / 3e-41 AT4G15733 65 / 2e-15 SCR-like 11 (.1)
Lus10033371
[exp]
110 / 1e-33 AT4G15733 71 / 6e-18 SCR-like 11 (.1)
Lus10034823
[exp]
102 / 6e-30 AT4G15733 66 / 7e-15 SCR-like 11 (.1)
Lus10034824
[exp]
100 / 8e-29 AT4G15733 63 / 9e-14 SCR-like 11 (.1)
Lus10033373
[exp]
97 / 1e-26 ND 64 / 3e-13
Lus10010504
[exp]
66 / 5e-16 AT4G22115 42 / 1e-06 SCR-like 14 (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.009G162300
[exp]
74 / 1e-19 AT4G15733 57 / 3e-12 SCR-like 11 (.1)
Potri.004G201100
[exp]
71 / 7e-18 AT4G15733 50 / 8e-10 SCR-like 11 (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0054 Knottin_1 PF06876 SCRL Plant self-incompatibility response (SCRL) protein
Representative CDS sequence
>Lus10029762 pacid=23152104 polypeptide=Lus10029762 locus=Lus10029762.g ID=Lus10029762.BGIv1.0 annot-version=v1.0
ATGAATCTCCAATATGTCTTAGATGATCTTAAGTGGTGCCCAAAGAAGGATGTGTTCACAGGAGGATGTGGAGGGCCGCAACAAAATCAATGTCTTCTGG
ACTTCTTAGGAAAGTACGGAGCTAGCAGCATGCCCAAAAACTGCATTTGCACTCCTGCCGGCACTGCACATTCTTGCACCTGCCAAGTTGTTTGTGGTTG
TTGCTAA
AA sequence
>Lus10029762 pacid=23152104 polypeptide=Lus10029762 locus=Lus10029762.g ID=Lus10029762.BGIv1.0 annot-version=v1.0
MNLQYVLDDLKWCPKKDVFTGGCGGPQQNQCLLDFLGKYGASSMPKNCICTPAGTAHSCTCQVVCGCC

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT4G15733 SCRL11 SCR-like 11 (.1) Lus10029762
[exp]
0 1
AT1G05020 ENTH/ANTH/VHS superfamily prot... Lus10035340
[exp]
1.0 0.9693
AT1G67623 F-box family protein (.1) Lus10006434
[exp]
8.8 0.9411
AT5G15430 Plant calmodulin-binding prote... Lus10021647
[exp]
9.3 0.8068
AT4G35890 winged-helix DNA-binding trans... Lus10025952
[exp]
11.8 0.8239
AT4G40070 RING/U-box superfamily protein... Lus10035931
[exp]
12.1 0.8936
Lus10038177
[exp]
14.3 0.7929
AT1G20925 Auxin efflux carrier family pr... Lus10004287
[exp]
15.9 0.7606
AT4G03220 Protein with RNI-like/FBD-like... Lus10023567
[exp]
19.9 0.8888
AT5G10840 Endomembrane protein 70 protei... Lus10010683
[exp]
20.3 0.6838
AT2G27410 B3 Domain of unknown function (DU... Lus10038980
[exp]
20.9 0.8067

Lus10029762 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.