Lus10029789 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT1G06400 373 / 3e-133 ARA2, AtRABA1a, AtRab11E, Ara-2 ARABIDOPSIS THALIANA RAB GTPASE HOMOLOG A1A, Ras-related small GTP-binding family protein (.1)
AT1G16920 355 / 3e-126 ATRABA4B, RAB11, ATRABA1B RAB GTPase homolog A1B (.1)
AT5G45750 350 / 3e-124 AtRABA1c RAB GTPase homolog A1C (.1)
AT4G18800 347 / 3e-123 AthSGBP, AtRab11B, AtRABA1d RAB GTPase homolog A1D (.1)
AT5G60860 330 / 4e-116 AtRABA1f RAB GTPase homolog A1F (.1)
AT3G15060 329 / 8e-116 AtRABA1g RAB GTPase homolog A1G (.1)
AT4G18430 325 / 3e-114 AtRABA1e RAB GTPase homolog A1E (.1)
AT1G28550 323 / 2e-113 AtRABA1i RAB GTPase homolog A1I (.1)
AT2G33870 317 / 5e-111 ArRABA1h RAB GTPase homolog A1H (.1)
AT1G09630 295 / 1e-102 ATRAB-A2A, ATRAB11C, ATRABA2A ARABIDOPSIS RAB GTPASE A2A, RAB GTPase 11C (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10020746 442 / 1e-160 AT1G06400 375 / 3e-134 ARABIDOPSIS THALIANA RAB GTPASE HOMOLOG A1A, Ras-related small GTP-binding family protein (.1)
Lus10029253 350 / 6e-124 AT5G45750 393 / 4e-141 RAB GTPase homolog A1C (.1)
Lus10007306 344 / 7e-122 AT5G45750 387 / 5e-139 RAB GTPase homolog A1C (.1)
Lus10017679 333 / 1e-117 AT5G60860 426 / 4e-154 RAB GTPase homolog A1F (.1)
Lus10002178 333 / 2e-117 AT5G60860 423 / 4e-153 RAB GTPase homolog A1F (.1)
Lus10015297 325 / 3e-114 AT5G60860 428 / 6e-155 RAB GTPase homolog A1F (.1)
Lus10025432 322 / 4e-113 AT5G60860 422 / 1e-152 RAB GTPase homolog A1F (.1)
Lus10013961 320 / 3e-112 AT5G60860 412 / 7e-149 RAB GTPase homolog A1F (.1)
Lus10039895 305 / 3e-106 AT5G60860 397 / 5e-143 RAB GTPase homolog A1F (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.011G070300 364 / 1e-129 AT5G45750 392 / 1e-140 RAB GTPase homolog A1C (.1)
Potri.004G061000 360 / 5e-128 AT4G18800 392 / 9e-141 RAB GTPase homolog A1D (.1)
Potri.001G374000 342 / 7e-121 AT5G60860 417 / 1e-150 RAB GTPase homolog A1F (.1)
Potri.013G123600 328 / 2e-115 AT5G60860 419 / 2e-151 RAB GTPase homolog A1F (.1)
Potri.019G092500 327 / 3e-115 AT5G60860 419 / 2e-151 RAB GTPase homolog A1F (.1)
Potri.011G061300 327 / 5e-115 AT5G60860 416 / 5e-150 RAB GTPase homolog A1F (.1)
Potri.003G004100 293 / 8e-102 AT1G09630 382 / 6e-137 ARABIDOPSIS RAB GTPASE A2A, RAB GTPase 11C (.1)
Potri.006G000300 291 / 8e-101 AT1G07410 400 / 4e-144 ARABIDOPSIS RAB GTPASE HOMOLOG A2B, RAB GTPase homolog A2B (.1)
Potri.016G000400 288 / 1e-99 AT1G07410 380 / 4e-136 ARABIDOPSIS RAB GTPASE HOMOLOG A2B, RAB GTPase homolog A2B (.1)
Potri.008G061300 287 / 2e-99 AT1G07410 367 / 9e-131 ARABIDOPSIS RAB GTPASE HOMOLOG A2B, RAB GTPase homolog A2B (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0023 P-loop_NTPase PF00071 Ras Ras family
Representative CDS sequence
>Lus10029789 pacid=23159751 polypeptide=Lus10029789 locus=Lus10029789.g ID=Lus10029789.BGIv1.0 annot-version=v1.0
ATGGCTGGCTACCGACCTGAAGAAGACTACGATTACTTGCTCAAGCTCGTTCTGATCGGCGATTCCGGTGTCGGCAAATCCAACTTGCTCTCCAGGTTCA
CCAAGAACGAGTTCAATCTCGAGTCCAAGTCCACTATCGGGGTCGAGTTCGCCACCAAGAGCATGAACCTCGATGGCAAGGTCATCAAGGCTCAGATTTG
GGACACCGCTGGCCAAGAAAGGTACCGCGCCATAACAAGCGCATACTACAGAGGAGCGGTCGGTGCTTTACTCGTCTACGACGTGACTCGCCGCTCAACA
TTCGAAAACGTGGCGAGGTGGCTGAAAGAGTTGAGGGAGCACACCGACCCCAACATCGTCGTCATGCTCATAGGCAACAAATCAGATCTCAGGCACCTGG
TAGCTGTCCAGACCGAGGATGCGAAAGCATATGCAGAGAGGGAGTCCATGTACTTAATGGAGACATCAGCTCTCACCGCAACAAACGTGGAGAGTGCCTT
CACCGAAGTCATGACGCAGATATACAAGATCGTGAGCAAGAGGGCTGTCGATGGAACCAATGACGGTACGACAGGAGTACCTCTGAAGGGAGAGACCATC
AACGTGAAGCAGGAAGGTTCTGTTCTCAAGAGAATGGGGTGCTGTTCTTAG
AA sequence
>Lus10029789 pacid=23159751 polypeptide=Lus10029789 locus=Lus10029789.g ID=Lus10029789.BGIv1.0 annot-version=v1.0
MAGYRPEEDYDYLLKLVLIGDSGVGKSNLLSRFTKNEFNLESKSTIGVEFATKSMNLDGKVIKAQIWDTAGQERYRAITSAYYRGAVGALLVYDVTRRST
FENVARWLKELREHTDPNIVVMLIGNKSDLRHLVAVQTEDAKAYAERESMYLMETSALTATNVESAFTEVMTQIYKIVSKRAVDGTNDGTTGVPLKGETI
NVKQEGSVLKRMGCCS

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT1G06400 ARA2, AtRABA1a,... ARABIDOPSIS THALIANA RAB GTPAS... Lus10029789 0 1
AT2G38610 RNA-binding KH domain-containi... Lus10034443 1.0 0.9111
AT4G23430 AtTic32-IVa translocon at the inner envelo... Lus10035481 2.0 0.8992
AT1G07080 Thioredoxin superfamily protei... Lus10026384 3.9 0.8839
AT1G55960 Polyketide cyclase/dehydrase a... Lus10033334 4.6 0.8931
AT2G36680 Modifier of rudimentary (Mod(r... Lus10014395 5.7 0.8895
AT2G45690 PEX16, SSE1, AT... SHRUNKEN SEED 1, ARABIDOPSIS P... Lus10036549 7.3 0.8481
AT5G05987 PRA1.A2 prenylated RAB acceptor 1.A2 (... Lus10030160 10.5 0.8695
AT5G65430 14-3-3KAPPA, GF... 14-3-3 PROTEIN G-BOX FACTOR14 ... Lus10035934 12.0 0.8680
AT2G16530 3-oxo-5-alpha-steroid 4-dehydr... Lus10042055 13.0 0.8817
AT1G65320 Cystathionine beta-synthase (C... Lus10037535 13.4 0.8457

Lus10029789 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.