Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT1G06400 61 / 6e-12 ARA2, AtRABA1a, AtRab11E, Ara-2 ARABIDOPSIS THALIANA RAB GTPASE HOMOLOG A1A, Ras-related small GTP-binding family protein (.1) AT1G28550 57 / 1e-10 AtRABA1i RAB GTPase homolog A1I (.1) AT5G45750 56 / 4e-10 AtRABA1c RAB GTPase homolog A1C (.1) AT3G15060 55 / 8e-10 AtRABA1g RAB GTPase homolog A1G (.1) AT1G16920 54 / 2e-09 ATRABA4B, RAB11, ATRABA1B RAB GTPase homolog A1B (.1) AT5G60860 53 / 4e-09 AtRABA1f RAB GTPase homolog A1F (.1) AT2G43130 52 / 7e-09 ARA4, AtRab11F, AtRABA5c, Ara-4 ARABIDOPSIS RAB GTPASE HOMOLOG A5C, P-loop containing nucleoside triphosphate hydrolases superfamily protein (.1) AT1G07410 50 / 6e-08 ATRAB-A2B, AtRABA2b ARABIDOPSIS RAB GTPASE HOMOLOG A2B, RAB GTPase homolog A2B (.1) AT4G18800 49 / 8e-08 AthSGBP, AtRab11B, AtRABA1d RAB GTPase homolog A1D (.1) AT2G33870 47 / 4e-07 ArRABA1h RAB GTPase homolog A1H (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10029789 [exp] 110 / 3e-31 AT1G06400 373 / 3e-133 ARABIDOPSIS THALIANA RAB GTPASE HOMOLOG A1A, Ras-related small GTP-binding family protein (.1) Lus10020746 [exp] 104 / 8e-29 AT1G06400 375 / 3e-134 ARABIDOPSIS THALIANA RAB GTPASE HOMOLOG A1A, Ras-related small GTP-binding family protein (.1) Lus10029253 [exp] 66 / 8e-14 AT5G45750 393 / 4e-141 RAB GTPase homolog A1C (.1) Lus10013961 [exp] 64 / 5e-13 AT5G60860 412 / 7e-149 RAB GTPase homolog A1F (.1) Lus10007306 [exp] 63 / 1e-12 AT5G45750 387 / 5e-139 RAB GTPase homolog A1C (.1) Lus10025432 [exp] 60 / 1e-11 AT5G60860 422 / 1e-152 RAB GTPase homolog A1F (.1) Lus10017679 [exp] 59 / 2e-11 AT5G60860 426 / 4e-154 RAB GTPase homolog A1F (.1) Lus10015297 [exp] 57 / 9e-11 AT5G60860 428 / 6e-155 RAB GTPase homolog A1F (.1) Lus10040745 [exp] 56 / 4e-10 AT1G07410 394 / 7e-142 ARABIDOPSIS RAB GTPASE HOMOLOG A2B, RAB GTPase homolog A2B (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.011G070300 [exp] 65 / 1e-13 AT5G45750 392 / 1e-140 RAB GTPase homolog A1C (.1) Potri.004G061000 [exp] 60 / 1e-11 AT4G18800 392 / 9e-141 RAB GTPase homolog A1D (.1) Potri.011G061300 [exp] 53 / 4e-09 AT5G60860 416 / 5e-150 RAB GTPase homolog A1F (.1) Potri.006G000300 [exp] 47 / 6e-07 AT1G07410 400 / 4e-144 ARABIDOPSIS RAB GTPASE HOMOLOG A2B, RAB GTPase homolog A2B (.1) Potri.001G374000 [exp] 45 / 2e-06 AT5G60860 417 / 1e-150 RAB GTPase homolog A1F (.1) Potri.016G000400 [exp] 44 / 5e-06 AT1G07410 380 / 4e-136 ARABIDOPSIS RAB GTPASE HOMOLOG A2B, RAB GTPase homolog A2B (.1) Potri.002G249500 [exp] 43 / 2e-05 AT1G05810 333 / 8e-117 ARABIDOPSIS THALIANA RAB GTPASE HOMOLOG A5E, RAB GTPase homolog A5E (.1) Potri.008G061300 [exp] 42 / 4e-05 AT1G07410 367 / 9e-131 ARABIDOPSIS RAB GTPASE HOMOLOG A2B, RAB GTPase homolog A2B (.1) Potri.014G049400 [exp] 40 / 0.0001 AT1G02130 390 / 2e-140 ARABIDOPSIS THALIANA RAB D2A, ARABIDOPSIS THALIANA RESPONSIVE TO ABSCISIC ACID 1B, ARABIDOPSIS RAS 5, RAS 5 (.1)
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10029790 pacid=23159794 polypeptide=Lus10029790 locus=Lus10029790.g ID=Lus10029790.BGIv1.0 annot-version=v1.0 ATGGAGGCAAACAAGGGGAAAAAACGAAGGCGGTCGGAATCGGAAGTTAAGAAAAAACCTTTCTTGGCCAGCGGTGTCCCAAATCTGAGCCTTGATGACC TTGCCATCGAGGTTCATGCTCTTGGTGGCGAACTCGACCCCGATAGTGGACTTGGACTCGAGATTGAACTCGTTCTTGGTGAACCTGGAGAGCAAGTTGG ATTTGCCGACACCGGAATCGCCGATCAGAACGAGCTTGAGCAAGTAATCGTAGTCTTCTTCAGGTCGGTAGCCAGCCATAATTACCCTTACCCCTTTTCG AGTTTTTTTCTCCTCCTCTTCTTGAGCTTCCTCAACGCAAGGTCAGGGGAGGGACAAGAGAATTATGGGACCTTGTTACACGATCTTCGGGAGCTGTTTT GA
AA sequence Show only first row Show all	>Lus10029790 pacid=23159794 polypeptide=Lus10029790 locus=Lus10029790.g ID=Lus10029790.BGIv1.0 annot-version=v1.0 MEANKGKKRRRSESEVKKKPFLASGVPNLSLDDLAIEVHALGGELDPDSGLGLEIELVLGEPGEQVGFADTGIADQNELEQVIVVFFRSVASHNYPYPFS SFFLLLFLSFLNARSGEGQENYGTLLHDLRELF

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
					Lus10029790 [exp]	0	1
AT5G08560			transducin family protein / WD...		Lus10001412 [exp]	1.4	0.9143
AT1G77410		BGAL16	beta-galactosidase 16 (.1)		Lus10028538 [exp]	2.4	0.8899
AT5G57500			Galactosyltransferase family p...		Lus10000407 [exp]	2.8	0.8890
AT5G02390		DAU1	DUO1-activated unknown 1, Prot...		Lus10016715 [exp]	4.2	0.8987
AT5G58050		GDPDL6, SVL4	Glycerophosphodiester phosphod...		Lus10000055 [exp]	5.5	0.8684
					Lus10017572 [exp]	8.1	0.8497
AT5G46060			Protein of unknown function, D...		Lus10005267 [exp]	19.0	0.8302
AT4G13450			Adenine nucleotide alpha hydro...		Lus10023716 [exp]	19.5	0.8444
AT2G44290			Bifunctional inhibitor/lipid-t...		Lus10017749 [exp]	20.8	0.8449
AT3G12340			FKBP-like peptidyl-prolyl cis-...		Lus10018845 [exp]	22.1	0.8184

Compare expression of checked genes

Lus10029790 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.