Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT3G29680 86 / 3e-20 HXXXD-type acyl-transferase family protein (.1) AT3G29635 83 / 3e-19 HXXXD-type acyl-transferase family protein (.1) AT5G39090 79 / 4e-18 HXXXD-type acyl-transferase family protein (.1) AT5G39080 78 / 1e-17 HXXXD-type acyl-transferase family protein (.1) AT5G61160 76 / 7e-17 AACT1 anthocyanin 5-aromatic acyltransferase 1 (.1) AT3G29670 76 / 9e-17 PMAT2 phenolic glucoside malonyltransferase 2, HXXXD-type acyl-transferase family protein (.1) AT3G29590 75 / 1e-16 AT5MAT HXXXD-type acyl-transferase family protein (.1) AT5G39050 71 / 3e-15 PMAT1 phenolic glucoside malonyltransferase 1, HXXXD-type acyl-transferase family protein (.1) AT1G03940 62 / 5e-12 HXXXD-type acyl-transferase family protein (.1) AT1G03495 58 / 1e-10 HXXXD-type acyl-transferase family protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10020721 [exp] 235 / 2e-76 AT5G39050 280 / 2e-89 phenolic glucoside malonyltransferase 1, HXXXD-type acyl-transferase family protein (.1) Lus10035802 [exp] 192 / 1e-59 AT5G39050 276 / 2e-87 phenolic glucoside malonyltransferase 1, HXXXD-type acyl-transferase family protein (.1) Lus10003344 [exp] 172 / 7e-56 AT3G29635 86 / 2e-20 HXXXD-type acyl-transferase family protein (.1) Lus10033599 [exp] 172 / 4e-52 AT3G29635 307 / 1e-99 HXXXD-type acyl-transferase family protein (.1) Lus10022646 [exp] 124 / 1e-36 AT5G39050 106 / 6e-27 phenolic glucoside malonyltransferase 1, HXXXD-type acyl-transferase family protein (.1) Lus10021390 [exp] 115 / 6e-31 AT3G29590 283 / 7e-91 HXXXD-type acyl-transferase family protein (.1) Lus10029276 [exp] 114 / 2e-30 AT5G39050 314 / 1e-102 phenolic glucoside malonyltransferase 1, HXXXD-type acyl-transferase family protein (.1) Lus10005362 [exp] 112 / 9e-30 AT3G29635 292 / 4e-94 HXXXD-type acyl-transferase family protein (.1) Lus10020514 [exp] 108 / 1e-28 AT3G29590 296 / 9e-96 HXXXD-type acyl-transferase family protein (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.004G103200 [exp] 131 / 8e-37 AT5G39050 374 / 1e-125 phenolic glucoside malonyltransferase 1, HXXXD-type acyl-transferase family protein (.1) Potri.004G103300 [exp] 125 / 6e-35 AT5G39050 352 / 3e-117 phenolic glucoside malonyltransferase 1, HXXXD-type acyl-transferase family protein (.1) Potri.004G103100 [exp] 125 / 8e-35 AT5G39050 366 / 1e-122 phenolic glucoside malonyltransferase 1, HXXXD-type acyl-transferase family protein (.1) Potri.004G120700 [exp] 125 / 1e-34 AT5G39050 343 / 1e-113 phenolic glucoside malonyltransferase 1, HXXXD-type acyl-transferase family protein (.1) Potri.010G208100 [exp] 123 / 5e-34 AT5G39050 332 / 3e-109 phenolic glucoside malonyltransferase 1, HXXXD-type acyl-transferase family protein (.1) Potri.004G110400 [exp] 120 / 8e-33 AT5G39050 363 / 2e-121 phenolic glucoside malonyltransferase 1, HXXXD-type acyl-transferase family protein (.1) Potri.004G110640 [exp] 120 / 8e-33 AT5G39050 365 / 2e-122 phenolic glucoside malonyltransferase 1, HXXXD-type acyl-transferase family protein (.1) Potri.004G110700 [exp] 119 / 1e-32 AT5G39050 369 / 1e-123 phenolic glucoside malonyltransferase 1, HXXXD-type acyl-transferase family protein (.1) Potri.004G109800 [exp] 117 / 8e-32 AT5G39050 368 / 2e-123 phenolic glucoside malonyltransferase 1, HXXXD-type acyl-transferase family protein (.1) Potri.004G109300 [exp] 117 / 1e-31 AT5G39050 365 / 3e-122 phenolic glucoside malonyltransferase 1, HXXXD-type acyl-transferase family protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0149 [flax] [poplar] CoA-acyltrans PF02458 [flax] [poplar] Transferase Transferase family
Representative CDS sequence Show only first row Show all	>Lus10029798 pacid=23159850 polypeptide=Lus10029798 locus=Lus10029798.g ID=Lus10029798.BGIv1.0 annot-version=v1.0 ATGGCTTCCAAACCGGCGGTCAAAGTCCTCGACGTTCTCAAAGTTACACCGGAAAAAGTCACGCCGAAACAGGCGCCGTCCACTCCATTCTCCCTCCCTC TAACCTTCTTCGACACTCTGTGGATTAAATTCCCTCCGGTTGAGCGCATCTTTCTCTACCAAGTCCCAAATCTATCCCCCGACTTATTCCGATCACAACT CATTCCAAAACTCTGTCGATCTCTGTCCCTCACTCTCCACTACTTCCTCCCTCTCGCCGGCAGCATCACTTGGCCTACTTACGACGTCGACGACGCCATC CTCCCGATCGTCCTCTACACCCCTGGAGATGCCGTCTTCCAAAGTGTCGCCGAGTCAACTGACAACTTTGACCGTATCGCCAGCGACGAAGTTCGCCAAG CTTCCGATTCACTTGCTTACATACCGTAG
AA sequence Show only first row Show all	>Lus10029798 pacid=23159850 polypeptide=Lus10029798 locus=Lus10029798.g ID=Lus10029798.BGIv1.0 annot-version=v1.0 MASKPAVKVLDVLKVTPEKVTPKQAPSTPFSLPLTFFDTLWIKFPPVERIFLYQVPNLSPDLFRSQLIPKLCRSLSLTLHYFLPLAGSITWPTYDVDDAI LPIVLYTPGDAVFQSVAESTDNFDRIASDEVRQASDSLAYIP

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT3G29680			HXXXD-type acyl-transferase fa...		Lus10029798 [exp]	0	1
AT2G40610		ATHEXPALPHA1.11...	expansin A8 (.1)		Lus10034227 [exp]	6.7	0.8352
AT5G23160			unknown protein		Lus10013437 [exp]	12.9	0.8449
AT5G18030			SAUR-like auxin-responsive pro...		Lus10027317 [exp]	15.1	0.8459
AT4G17486			PPPDE putative thiol peptidase...		Lus10019437 [exp]	15.9	0.7995
AT1G23965			unknown protein		Lus10030844 [exp]	22.1	0.8289
AT5G43700	AUX_IAA	IAA4, ATAUX2-11	indole-3-acetic acid inducible...		Lus10018764 [exp]	28.2	0.8159
AT5G39050		PMAT1	phenolic glucoside malonyltran...		Lus10029797 [exp]	28.6	0.8084
AT2G40230			HXXXD-type acyl-transferase fa...		Lus10007509 [exp]	30.5	0.7738
AT5G24550		BGLU32	beta glucosidase 32 (.1)		Lus10030518 [exp]	34.6	0.8042
AT2G18300	bHLH	bHLH064, HBI1	basic helix-loop-helix (bHLH) ...		Lus10014300 [exp]	34.9	0.8141

Compare expression of checked genes

Lus10029798 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.