Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT4G12010 110 / 1e-29 Disease resistance protein (TIR-NBS-LRR class) family (.1) AT1G72930 97 / 3e-27 TIR toll/interleukin-1 receptor-like (.1.2) AT1G72920 99 / 2e-26 Toll-Interleukin-Resistance (TIR) domain family protein (.1) AT5G36930 99 / 2e-25 Disease resistance protein (TIR-NBS-LRR class) family (.1), Disease resistance protein (TIR-NBS-LRR class) family (.2) AT4G19510 98 / 3e-25 Disease resistance protein (TIR-NBS-LRR class) (.1), Disease resistance protein (TIR-NBS-LRR class) (.2) AT1G72910 97 / 3e-25 Toll-Interleukin-Resistance (TIR) domain-containing protein (.1) AT1G72940 97 / 3e-25 Toll-Interleukin-Resistance (TIR) domain-containing protein (.1) AT1G72900 96 / 5e-25 Toll-Interleukin-Resistance (TIR) domain-containing protein (.1) AT1G72840 97 / 6e-25 Disease resistance protein (TIR-NBS-LRR class) (.1), Disease resistance protein (TIR-NBS-LRR class) (.2) AT4G16890 97 / 1e-24 BAL, SNC1 SUPPRESSOR OF NPR1-1, CONSTITUTIVE 1, BALL, disease resistance protein (TIR-NBS-LRR class), putative (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10026201 [exp] 192 / 5e-58 AT5G17680 511 / 1e-160 disease resistance protein (TIR-NBS-LRR class), putative (.1) Lus10005588 [exp] 167 / 1e-49 AT5G17680 499 / 2e-156 disease resistance protein (TIR-NBS-LRR class), putative (.1) Lus10013729 [exp] 157 / 3e-46 AT5G36930 310 / 2e-92 Disease resistance protein (TIR-NBS-LRR class) family (.1), Disease resistance protein (TIR-NBS-LRR class) family (.2) Lus10042752 [exp] 109 / 8e-32 AT4G16990 145 / 5e-41 RESISTANCE TO LEPTOSPHAERIA MACULANS 3, disease resistance protein (TIR-NBS class), putative Lus10011104 [exp] 115 / 3e-31 AT5G17680 574 / 0.0 disease resistance protein (TIR-NBS-LRR class), putative (.1) Lus10014829 [exp] 108 / 8e-29 AT5G17680 441 / 1e-136 disease resistance protein (TIR-NBS-LRR class), putative (.1) Lus10003749 [exp] 108 / 1e-28 AT5G17680 517 / 5e-161 disease resistance protein (TIR-NBS-LRR class), putative (.1) Lus10006929 [exp] 104 / 1e-28 AT1G72890 146 / 1e-39 Disease resistance protein (TIR-NBS class) (.1), Disease resistance protein (TIR-NBS class) (.2) Lus10014671 [exp] 102 / 4e-28 AT5G36930 144 / 4e-39 Disease resistance protein (TIR-NBS-LRR class) family (.1), Disease resistance protein (TIR-NBS-LRR class) family (.2)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.019G070436 [exp] 127 / 1e-38 AT2G20142 160 / 7e-49 Toll-Interleukin-Resistance (TIR) domain family protein (.1) Potri.019G069866 [exp] 124 / 6e-37 AT4G12010 179 / 4e-52 Disease resistance protein (TIR-NBS-LRR class) family (.1) Potri.019G068300 [exp] 128 / 8e-36 AT5G17680 580 / 0.0 disease resistance protein (TIR-NBS-LRR class), putative (.1) Potri.019G070651 [exp] 125 / 1e-34 AT5G17680 630 / 0.0 disease resistance protein (TIR-NBS-LRR class), putative (.1) Potri.017G105501 [exp] 117 / 1e-34 AT5G36930 158 / 4e-45 Disease resistance protein (TIR-NBS-LRR class) family (.1), Disease resistance protein (TIR-NBS-LRR class) family (.2) Potri.019G069600 [exp] 124 / 2e-34 AT5G17680 647 / 0.0 disease resistance protein (TIR-NBS-LRR class), putative (.1) Potri.019G070393 [exp] 124 / 2e-34 AT5G17680 629 / 0.0 disease resistance protein (TIR-NBS-LRR class), putative (.1) Potri.019G070700 [exp] 124 / 2e-34 AT5G17680 722 / 0.0 disease resistance protein (TIR-NBS-LRR class), putative (.1) Potri.017G105201 [exp] 124 / 3e-34 AT4G12010 549 / 4e-174 Disease resistance protein (TIR-NBS-LRR class) family (.1) Potri.013G098100 [exp] 115 / 3e-34 AT5G36930 159 / 1e-45 Disease resistance protein (TIR-NBS-LRR class) family (.1), Disease resistance protein (TIR-NBS-LRR class) family (.2)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0173 [flax] [poplar] STIR PF01582 [flax] [poplar] TIR TIR domain
Representative CDS sequence Show only first row Show all	>Lus10029810 pacid=23159883 polypeptide=Lus10029810 locus=Lus10029810.g ID=Lus10029810.BGIv1.0 annot-version=v1.0 ATGTACGATGTGTTCCTCAGTTTCAGAGGAGCAGACACCCGCCTCAATTTCAACAGCCATCTCTACGCAGCTCTTAGAGGCCGGTCAATCCTCAGTTACA TCGACGATGTCAACCTCCGGCGAGGTGCGGACATCACCGACACCTTGCTCAAAGAGATTGAGCAGTCCAAGATGGCCGTCATTATCTTCTCCGATAACTA CGCTTCCTACGGATGGTGCCTGGATGAGCTCGTCAAAATCCTCCACTGCCGGAAACACTTCAGTCAGGTGGTTTTACCGGTCTTCAATGGCGTCTCTCTC TCTCTCTAA
AA sequence Show only first row Show all	>Lus10029810 pacid=23159883 polypeptide=Lus10029810 locus=Lus10029810.g ID=Lus10029810.BGIv1.0 annot-version=v1.0 MYDVFLSFRGADTRLNFNSHLYAALRGRSILSYIDDVNLRRGADITDTLLKEIEQSKMAVIIFSDNYASYGWCLDELVKILHCRKHFSQVVLPVFNGVSL SL

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT4G12010			Disease resistance protein (TI...		Lus10029810 [exp]	0	1
AT4G11280		ATACS6, ACS6	1-aminocyclopropane-1-carboxyl...		Lus10028760 [exp]	7.4	0.6575
AT4G18540			unknown protein		Lus10036093 [exp]	8.5	0.6078
AT5G36930			Disease resistance protein (TI...		Lus10029811 [exp]	9.7	0.6136
AT3G63120		CYCP1;1	cyclin p1;1 (.1)		Lus10022038 [exp]	12.6	0.6316
AT2G28250		NCRK	Protein kinase superfamily pro...		Lus10016098 [exp]	50.7	0.5673
AT3G23160			Protein of unknown function (D...		Lus10021210 [exp]	54.5	0.5441
AT2G34930			disease resistance family prot...		Lus10039522 [exp]	54.7	0.5545
AT4G12610		RAP74, ATRAP74	transcription activators;DNA b...		Lus10017289 [exp]	57.1	0.5647
AT2G26450			Plant invertase/pectin methyle...		Lus10002976 [exp]	62.0	0.5566
AT2G38760		ANN3, ANNAT3	annexin 3 (.1)		Lus10039547 [exp]	67.7	0.5331

Compare expression of checked genes

Lus10029810 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.