Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT5G36930 50 / 6e-09 Disease resistance protein (TIR-NBS-LRR class) family (.1), Disease resistance protein (TIR-NBS-LRR class) family (.2) AT5G38350 49 / 2e-08 Disease resistance protein (NBS-LRR class) family (.1) AT4G12010 47 / 7e-08 Disease resistance protein (TIR-NBS-LRR class) family (.1) AT5G41540 46 / 2e-07 Disease resistance protein (TIR-NBS-LRR class) family (.1) AT4G11170 45 / 5e-07 Disease resistance protein (TIR-NBS-LRR class) family (.1) AT4G19520 44 / 9e-07 disease resistance protein (TIR-NBS-LRR class) family (.1) AT5G41740 44 / 2e-06 Disease resistance protein (TIR-NBS-LRR class) family (.1), Disease resistance protein (TIR-NBS-LRR class) family (.2) AT5G40910 43 / 2e-06 Disease resistance protein (TIR-NBS-LRR class) family (.1) AT3G25510 43 / 3e-06 disease resistance protein (TIR-NBS-LRR class), putative (.1) AT1G27170 43 / 3e-06 transmembrane receptors;ATP binding (.1.2)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10026201 [exp] 117 / 2e-32 AT5G17680 511 / 1e-160 disease resistance protein (TIR-NBS-LRR class), putative (.1) Lus10028343 [exp] 103 / 4e-29 AT3G44670 147 / 4e-40 Disease resistance protein (TIR-NBS-LRR class) family (.1), Disease resistance protein (TIR-NBS-LRR class) family (.2) Lus10005588 [exp] 90 / 8e-23 AT5G17680 499 / 2e-156 disease resistance protein (TIR-NBS-LRR class), putative (.1) Lus10013729 [exp] 65 / 5e-14 AT5G36930 310 / 2e-92 Disease resistance protein (TIR-NBS-LRR class) family (.1), Disease resistance protein (TIR-NBS-LRR class) family (.2) Lus10020536 [exp] 60 / 3e-12 AT1G27170 392 / 8e-118 transmembrane receptors;ATP binding (.1.2) Lus10020537 [exp] 59 / 8e-12 AT1G27170 404 / 6e-121 transmembrane receptors;ATP binding (.1.2) Lus10020524 [exp] 59 / 9e-12 AT1G27170 395 / 9e-119 transmembrane receptors;ATP binding (.1.2) Lus10008414 [exp] 53 / 3e-11 AT1G27170 61 / 7e-13 transmembrane receptors;ATP binding (.1.2) Lus10029628 [exp] 56 / 8e-11 AT1G27180 462 / 1e-138 disease resistance protein (TIR-NBS-LRR class), putative (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.017G010800 [exp] 62 / 3e-13 AT5G17680 592 / 0.0 disease resistance protein (TIR-NBS-LRR class), putative (.1) Potri.019G068200 [exp] 61 / 1e-12 AT5G17680 629 / 0.0 disease resistance protein (TIR-NBS-LRR class), putative (.1) Potri.019G070001 [exp] 54 / 3e-10 AT5G17680 481 / 5e-148 disease resistance protein (TIR-NBS-LRR class), putative (.1) Potri.019G070565 [exp] 54 / 5e-10 AT5G17680 482 / 3e-148 disease resistance protein (TIR-NBS-LRR class), putative (.1) Potri.019G068300 [exp] 53 / 1e-09 AT5G17680 580 / 0.0 disease resistance protein (TIR-NBS-LRR class), putative (.1) Potri.019G002500 [exp] 50 / 5e-09 AT5G17680 587 / 0.0 disease resistance protein (TIR-NBS-LRR class), putative (.1) Potri.019G070300 [exp] 47 / 2e-07 AT5G17680 558 / 0.0 disease resistance protein (TIR-NBS-LRR class), putative (.1) Potri.019G070700 [exp] 46 / 2e-07 AT5G17680 722 / 0.0 disease resistance protein (TIR-NBS-LRR class), putative (.1) Potri.001G307300 [exp] 46 / 2e-07 AT5G17680 597 / 0.0 disease resistance protein (TIR-NBS-LRR class), putative (.1) Potri.019G069200 [exp] 44 / 9e-07 AT5G17680 590 / 0.0 disease resistance protein (TIR-NBS-LRR class), putative (.1)
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10029811 pacid=23159654 polypeptide=Lus10029811 locus=Lus10029811.g ID=Lus10029811.BGIv1.0 annot-version=v1.0 ATGGGTGGTGTGGGCAAAACCACCCTTGCTAGAGCTACATACGATGAGTTCTCATCAAATTTTGAAGCGTGTCATTTCCTAGGCAACATAAGGGAAGAAT TGGGAAGGCGCTCTGAACTTGGCTTGCAACACGAGCTCTTCTCAAGCATACTGGAGGATGATGATCCCCCCAACTCAAAGAAGCACAGATTTGGCGCCGA CTGTAGCGAACAGTAA
AA sequence Show only first row Show all	>Lus10029811 pacid=23159654 polypeptide=Lus10029811 locus=Lus10029811.g ID=Lus10029811.BGIv1.0 annot-version=v1.0 MGGVGKTTLARATYDEFSSNFEACHFLGNIREELGRRSELGLQHELFSSILEDDDPPNSKKHRFGADCSEQ

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT5G36930			Disease resistance protein (TI...		Lus10029811 [exp]	0	1
AT4G12010			Disease resistance protein (TI...		Lus10029810 [exp]	9.7	0.6136
AT3G23160			Protein of unknown function (D...		Lus10021210 [exp]	10.6	0.6308
AT1G18210			Calcium-binding EF-hand family...		Lus10042008 [exp]	12.9	0.6681
AT1G16560			Per1-like family protein (.1.2...		Lus10027411 [exp]	17.9	0.6211
AT5G36890		BGLU42	beta glucosidase 42 (.1.2)		Lus10026861 [exp]	20.3	0.6429
AT4G26620			Sucrase/ferredoxin-like family...		Lus10022532 [exp]	41.4	0.5957
AT1G08820		VAP27-2	vamp/synaptobrevin-associated ...		Lus10033837 [exp]	42.5	0.6351
AT2G28250		NCRK	Protein kinase superfamily pro...		Lus10016098 [exp]	52.6	0.5970
AT4G11280		ATACS6, ACS6	1-aminocyclopropane-1-carboxyl...		Lus10028760 [exp]	54.0	0.6117
AT2G36290			alpha/beta-Hydrolases superfam...		Lus10039775 [exp]	95.5	0.5953

Compare expression of checked genes

Lus10029811 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.