Lus10029812 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT5G45890 174 / 3e-54 SAG12 senescence-associated gene 12 (.1)
AT5G50260 172 / 1e-53 CEP1 cysteine endopeptidase 1, Cysteine proteinases superfamily protein (.1)
AT3G48340 172 / 2e-53 CEP2 cysteine endopeptidase 2, Cysteine proteinases superfamily protein (.1)
AT5G43060 167 / 2e-50 Granulin repeat cysteine protease family protein (.1)
AT3G19390 162 / 6e-49 Granulin repeat cysteine protease family protein (.1)
AT3G48350 160 / 1e-48 CEP3 cysteine endopeptidase 3, Cysteine proteinases superfamily protein (.1)
AT1G06260 156 / 1e-47 Cysteine proteinases superfamily protein (.1)
AT1G47128 156 / 2e-46 RD21A, RD21 RESPONSIVE TO DEHYDRATION 21A, responsive to dehydration 21, Granulin repeat cysteine protease family protein (.1)
AT1G20850 153 / 5e-46 XCP2 xylem cysteine peptidase 2 (.1)
AT1G09850 154 / 1e-45 XBCP3 xylem bark cysteine peptidase 3 (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10020730 270 / 7e-92 AT5G45890 392 / 1e-136 senescence-associated gene 12 (.1)
Lus10020722 256 / 1e-86 AT5G45890 392 / 1e-136 senescence-associated gene 12 (.1)
Lus10028501 255 / 5e-86 AT5G45890 391 / 2e-136 senescence-associated gene 12 (.1)
Lus10028502 255 / 6e-86 AT5G45890 394 / 3e-137 senescence-associated gene 12 (.1)
Lus10029799 254 / 7e-86 AT5G45890 393 / 3e-137 senescence-associated gene 12 (.1)
Lus10042295 254 / 8e-86 AT5G45890 402 / 7e-141 senescence-associated gene 12 (.1)
Lus10032406 253 / 2e-85 AT5G45890 391 / 2e-136 senescence-associated gene 12 (.1)
Lus10004781 251 / 2e-85 AT5G45890 227 / 7e-73 senescence-associated gene 12 (.1)
Lus10020723 252 / 6e-85 AT5G45890 398 / 3e-139 senescence-associated gene 12 (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.005G089100 214 / 4e-70 AT5G45890 405 / 1e-141 senescence-associated gene 12 (.1)
Potri.007G076000 213 / 1e-69 AT5G45890 407 / 2e-142 senescence-associated gene 12 (.1)
Potri.007G076100 213 / 2e-69 AT5G45890 411 / 7e-144 senescence-associated gene 12 (.1)
Potri.007G075900 213 / 2e-69 AT5G45890 411 / 7e-144 senescence-associated gene 12 (.1)
Potri.005G088600 213 / 3e-69 AT5G45890 406 / 8e-142 senescence-associated gene 12 (.1)
Potri.007G075300 213 / 3e-69 AT5G45890 406 / 6e-142 senescence-associated gene 12 (.1)
Potri.013G118200 203 / 3e-66 AT5G45890 387 / 2e-135 senescence-associated gene 12 (.1)
Potri.011G064900 201 / 7e-65 AT5G45890 401 / 3e-140 senescence-associated gene 12 (.1)
Potri.013G126100 199 / 4e-64 AT5G45890 386 / 2e-134 senescence-associated gene 12 (.1)
Potri.013G118400 197 / 2e-63 AT5G45890 378 / 2e-131 senescence-associated gene 12 (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0125 Peptidase_CA PF00112 Peptidase_C1 Papain family cysteine protease
Representative CDS sequence
>Lus10029812 pacid=23159799 polypeptide=Lus10029812 locus=Lus10029812.g ID=Lus10029812.BGIv1.0 annot-version=v1.0
ATGGATGATGCTTTCAAGTTCGTTATTCAAAACAAGGGATTGACCACCGAGACCAACTACCCTTATGACGCTGCTGATGGAACCTGCAATGCTAACAAAG
AAAGCCGCAGTGCAGCCAACAACGAGGCCGCATTGATGAAGGCTGTGGCGAGCCAACCGATATCAGTTGCAATTGATGCAGGGGATTCGTCATTCCAATC
CTACTCTAGTGGAATTTTCACAGGAGAATGTGGGAGCGAGCTAGACCATGGAGCGACGGCAATTGGGTATGGAGAGAGCGGTGGGAAGAAGTACTGGTTG
GTGAAGAACTCATGGGGAGCACTGTGGGGAAAAGCCGGATACACTCGTATGCAGAAAGATGTTACCACTAAAGAAGGTCTGTGCGGAATTGCCAGGCAAG
CTTCCTATCCTACTGATTCCCACTGCCCAAGTGAAAAGATATAG
AA sequence
>Lus10029812 pacid=23159799 polypeptide=Lus10029812 locus=Lus10029812.g ID=Lus10029812.BGIv1.0 annot-version=v1.0
MDDAFKFVIQNKGLTTETNYPYDAADGTCNANKESRSAANNEAALMKAVASQPISVAIDAGDSSFQSYSSGIFTGECGSELDHGATAIGYGESGGKKYWL
VKNSWGALWGKAGYTRMQKDVTTKEGLCGIARQASYPTDSHCPSEKI

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT5G45890 SAG12 senescence-associated gene 12 ... Lus10029812 0 1
AT5G36930 Disease resistance protein (TI... Lus10026707 1.4 0.8086
AT1G06620 2-oxoglutarate (2OG) and Fe(II... Lus10033877 2.4 0.7249
AT1G04560 AWPM-19-like family protein (.... Lus10033541 8.9 0.6754
AT4G33985 Protein of unknown function (D... Lus10002400 13.9 0.6805
Lus10010117 14.5 0.6639
Lus10002152 15.5 0.6639
Lus10005187 16.4 0.6639
AT4G25650 TIC55-IV, PTC52... TRANSLOCON AT THE INNER ENVELO... Lus10025408 17.3 0.6639
AT4G12560 CPR1, CPR30 CONSTITUTIVE EXPRESSER OF PR G... Lus10040338 18.2 0.6639
AT2G25010 Aminotransferase-like, plant m... Lus10008761 19.0 0.6639

Lus10029812 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.