Lus10029814 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT5G45890 145 / 1e-42 SAG12 senescence-associated gene 12 (.1)
AT3G19390 142 / 1e-40 Granulin repeat cysteine protease family protein (.1)
AT2G27420 138 / 1e-39 Cysteine proteinases superfamily protein (.1)
AT3G49340 138 / 1e-39 Cysteine proteinases superfamily protein (.1)
AT4G35350 135 / 5e-39 XCP1 xylem cysteine peptidase 1 (.1.2)
AT1G29090 136 / 7e-39 Cysteine proteinases superfamily protein (.1)
AT3G19400 133 / 2e-38 Cysteine proteinases superfamily protein (.1.2)
AT1G29080 129 / 2e-36 Papain family cysteine protease (.1)
AT2G34080 129 / 2e-36 Cysteine proteinases superfamily protein (.1)
AT3G43960 129 / 4e-36 Cysteine proteinases superfamily protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10020734 318 / 5e-110 AT5G45890 390 / 4e-136 senescence-associated gene 12 (.1)
Lus10028501 309 / 2e-106 AT5G45890 391 / 2e-136 senescence-associated gene 12 (.1)
Lus10006542 308 / 3e-106 AT5G45890 391 / 2e-136 senescence-associated gene 12 (.1)
Lus10020730 308 / 8e-106 AT5G45890 392 / 1e-136 senescence-associated gene 12 (.1)
Lus10026073 301 / 2e-103 AT5G45890 393 / 5e-137 senescence-associated gene 12 (.1)
Lus10032406 301 / 2e-103 AT5G45890 391 / 2e-136 senescence-associated gene 12 (.1)
Lus10003275 300 / 8e-103 AT5G45890 392 / 1e-136 senescence-associated gene 12 (.1)
Lus10009145 298 / 7e-102 AT5G45890 396 / 4e-138 senescence-associated gene 12 (.1)
Lus10020723 296 / 2e-101 AT5G45890 398 / 3e-139 senescence-associated gene 12 (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.005G088600 230 / 2e-75 AT5G45890 406 / 8e-142 senescence-associated gene 12 (.1)
Potri.005G089100 229 / 3e-75 AT5G45890 405 / 1e-141 senescence-associated gene 12 (.1)
Potri.007G075300 228 / 1e-74 AT5G45890 406 / 6e-142 senescence-associated gene 12 (.1)
Potri.007G076100 228 / 3e-74 AT5G45890 411 / 7e-144 senescence-associated gene 12 (.1)
Potri.007G075900 228 / 3e-74 AT5G45890 411 / 7e-144 senescence-associated gene 12 (.1)
Potri.007G076000 224 / 2e-73 AT5G45890 407 / 2e-142 senescence-associated gene 12 (.1)
Potri.007G075100 209 / 7e-68 AT5G45890 371 / 4e-129 senescence-associated gene 12 (.1)
Potri.011G064900 199 / 3e-63 AT5G45890 401 / 3e-140 senescence-associated gene 12 (.1)
Potri.013G126100 187 / 6e-59 AT5G45890 386 / 2e-134 senescence-associated gene 12 (.1)
Potri.013G118200 182 / 2e-57 AT5G45890 387 / 2e-135 senescence-associated gene 12 (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0125 Peptidase_CA PF00112 Peptidase_C1 Papain family cysteine protease
CL0125 PF08246 Inhibitor_I29 Cathepsin propeptide inhibitor domain (I29)
Representative CDS sequence
>Lus10029814 pacid=23159646 polypeptide=Lus10029814 locus=Lus10029814.g ID=Lus10029814.BGIv1.0 annot-version=v1.0
ATGGGGCCCTTGAACAAAAATTTCATTCTCTTGGCTTCCATATTCATCCTGGGAGCTCTGGCTTCTCACACCACGGCACGCTATACCCTTTCTGAAGCTG
CCATGCGAGTCAGGTATGAGCAATGGATGACTCGTTATGGCATAGTCTACAACAGTGCCACTGAAAAGGAGGCTCGATTCCTGATCTTCAAAGACAACGT
AGCTTTCATTGACTCTTCCAATGCTGCTGGAAATAAGACTTACAAGCTTGGAGTCAATCAGTTTGCTGATTTTACTAAGGACGAATTCAAAGCCTCTAGA
AACGGGTTCAAAGGACACATGTGCTCTCCCCAACATGGAACTTTTAGGTACGACAATGTGAGTTCGGTCCCAACGACCATGGACTGGAGGAAGAAGGGAG
CAGTCACTCCTATCAAAGACCAGGGTCAGTGCGGAAGCTGTTGGGCATTTTCGGCCGTGGGAGCCATGGAAGGAATCCACCAGCTCAGTACGGGAAAGTT
TGGTCGTCTCTTTCGGAGCAAGAATTGGTCGACTGCGACACCAAGGGAGAGGACCAAGGATGCAACAGCGGGTTGA
AA sequence
>Lus10029814 pacid=23159646 polypeptide=Lus10029814 locus=Lus10029814.g ID=Lus10029814.BGIv1.0 annot-version=v1.0
MGPLNKNFILLASIFILGALASHTTARYTLSEAAMRVRYEQWMTRYGIVYNSATEKEARFLIFKDNVAFIDSSNAAGNKTYKLGVNQFADFTKDEFKASR
NGFKGHMCSPQHGTFRYDNVSSVPTTMDWRKKGAVTPIKDQGQCGSCWAFSAVGAMEGIHQLSTGKFGRLFRSKNWSTATPRERTKDATAG

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT5G45890 SAG12 senescence-associated gene 12 ... Lus10029814 0 1
AT4G13720 Inosine triphosphate pyrophosp... Lus10011757 15.7 0.7834
AT3G06778 Chaperone DnaJ-domain superfam... Lus10037711 25.5 0.7155
AT5G19640 Major facilitator superfamily ... Lus10039204 29.7 0.7601
AT5G64620 ATC/VIF2, C/VIF... cell wall / vacuolar inhibitor... Lus10020664 53.0 0.7305
AT4G37280 MRG family protein (.1) Lus10019312 55.3 0.7271
AT2G41945 unknown protein Lus10029305 55.3 0.6950
AT1G26340 B5 #6, B5#6, AT... ARABIDOPSIS CYTOCHROME B5 ISOF... Lus10000651 57.5 0.7540
AT5G11010 Pre-mRNA cleavage complex II p... Lus10036655 66.0 0.7533
AT3G20190 Leucine-rich repeat protein ki... Lus10033339 72.7 0.7475
AT3G22290 Endoplasmic reticulum vesicle ... Lus10021024 99.2 0.7308

Lus10029814 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.