Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	No hit found
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10020714 [exp] 100 / 7e-26 AT1G03495 337 / 1e-111 HXXXD-type acyl-transferase family protein (.1) Lus10033754 [exp] 58 / 1e-10 AT1G03495 299 / 1e-96 HXXXD-type acyl-transferase family protein (.1) Lus10031587 [exp] 56 / 4e-10 AT1G03495 305 / 7e-99 HXXXD-type acyl-transferase family protein (.1) Lus10039720 [exp] 43 / 3e-06 AT1G03495 45 / 9e-07 HXXXD-type acyl-transferase family protein (.1) Lus10018507 [exp] 43 / 2e-05 AT1G03495 286 / 2e-90 HXXXD-type acyl-transferase family protein (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.019G118101 [exp] 55 / 1e-09 AT1G03940 339 / 2e-112 HXXXD-type acyl-transferase family protein (.1) Potri.019G118000 [exp] 40 / 0.0001 AT1G03940 328 / 6e-108 HXXXD-type acyl-transferase family protein (.1) Potri.004G103100 [exp] 40 / 0.0001 AT5G39050 366 / 1e-122 phenolic glucoside malonyltransferase 1, HXXXD-type acyl-transferase family protein (.1) Potri.009G019700 [exp] 40 / 0.0002 AT3G29590 304 / 1e-98 HXXXD-type acyl-transferase family protein (.1) Potri.004G103200 [exp] 39 / 0.0003 AT5G39050 374 / 1e-125 phenolic glucoside malonyltransferase 1, HXXXD-type acyl-transferase family protein (.1)
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10029825 pacid=23159738 polypeptide=Lus10029825 locus=Lus10029825.g ID=Lus10029825.BGIv1.0 annot-version=v1.0 ATGGCCGCCAACAATCATCAACAAATCAACCCACTCCACCACTTCCAAGTCTCTCCGCCACTGGGAACTCTCCCGTCCGCCACCGTCACCCTTCCGATCA CCTTCTTCGACGTCCTACGGCTCAACTCCCGCCCCATGCGCCGTCTCTTCTTCTACGACTTTTCCCTCACCCAACCACTTCACCCAATCCATCCTTCCCA ACCTCCGCCGCTCCCTCTCAATCTCCCTCCAGCACTTCTTCCCGCTCCCCGGAAACCTCGTCGTCCCCCCTCCTCAGCCGCCTCAGCCGCCTTTCTTCTG CTTCTCCGACGGCGTCGACTCTGTCTCGCTCACAATAGCGGAGTCAACGTTGGATTACGACCAGTTGACTAA
AA sequence Show only first row Show all	>Lus10029825 pacid=23159738 polypeptide=Lus10029825 locus=Lus10029825.g ID=Lus10029825.BGIv1.0 annot-version=v1.0 MAANNHQQINPLHHFQVSPPLGTLPSATVTLPITFFDVLRLNSRPMRRLFFYDFSLTQPLHPIHPSQPPPLPLNLPPALLPAPRKPRRPPSSAASAAFLL LLRRRRLCLAHNSGVNVGLRPVD

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
					Lus10029825 [exp]	0	1
AT2G01770		ATVIT1, VIT1	vacuolar iron transporter 1 (....		Lus10001589 [exp]	1.7	0.9054
AT5G39190		ATGER2, GLP2A	GERMIN-LIKE PROTEIN 2A, A. THA...		Lus10035186 [exp]	3.5	0.8933
AT1G01490			Heavy metal transport/detoxifi...		Lus10027523 [exp]	7.7	0.9051
AT1G79690		ATNUDT3	nudix hydrolase homolog 3 (.1)		Lus10041626 [exp]	8.7	0.8710
AT3G12910	NAC		NAC (No Apical Meristem) domai...		Lus10031189 [exp]	13.3	0.8465
AT2G47810	CCAAT	NF-YB5	"nuclear factor Y, subunit B5"...		Lus10008383 [exp]	19.8	0.8008
AT2G41480			Peroxidase superfamily protein...		Lus10012684 [exp]	23.4	0.8758
AT4G36810		GGPS1	geranylgeranyl pyrophosphate s...		Lus10033582 [exp]	32.3	0.8495
					Lus10029451 [exp]	33.7	0.8315
AT3G53820	C2H2ZnF		C2H2 and C2HC zinc fingers sup...		Lus10024363 [exp]	36.3	0.8664

Compare expression of checked genes

Lus10029825 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.