Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	No hit found
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10018643 [exp] 88 / 9e-24 ND / Lus10039880 [exp] 77 / 6e-18 AT1G28490 271 / 4e-91 syntaxin of plants 61 (.1.2) Lus10018645 [exp] 63 / 9e-14 ND 35 / 0.004 Lus10042963 [exp] 62 / 2e-13 ND / Lus10018647 [exp] 38 / 0.0002 AT5G09520 45 / 5e-07 Pro-Glu-Leu|Ile|Val-Pro-Lys 2, hydroxyproline-rich glycoprotein family protein (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.017G046750 [exp] 40 / 9e-05 ND / Potri.019G082733 [exp] 39 / 0.0002 ND /
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10029845 pacid=23159690 polypeptide=Lus10029845 locus=Lus10029845.g ID=Lus10029845.BGIv1.0 annot-version=v1.0 ATGGCATCATCTTCCAAATCTTTCTGCTTCCTCTTTGCCCTCCTCGTTGCTGTCTCATTCTCCAACATTGACGCCGGAATGGCGGCTAGCCACCTCCTCC AAGCTCCGACTCTGCCAAAGCCAGCTGCGTTGCCTCCTCTGCCAACTATCCCAACTCTGCCTCAGCCGAGTCTGCCCCAGCCGAGTCTGCCTACTGTCGG ACTGCCACCACTCCCTGCCATGCCGGCCATTCCTACAATTCCTACTGTTAACATCCCGAAGGTTTCCCTGCCGCCATTGCCTAGCAACTTCCCTTCGATA CCGTTCAACATGCCTTCCATCCCTGGCCTCACCACGCCACCTCCTAGCAACTAG
AA sequence Show only first row Show all	>Lus10029845 pacid=23159690 polypeptide=Lus10029845 locus=Lus10029845.g ID=Lus10029845.BGIv1.0 annot-version=v1.0 MASSSKSFCFLFALLVAVSFSNIDAGMAASHLLQAPTLPKPAALPPLPTIPTLPQPSLPQPSLPTVGLPPLPAMPAIPTIPTVNIPKVSLPPLPSNFPSI PFNMPSIPGLTTPPPSN

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT4G38080			hydroxyproline-rich glycoprote...		Lus10029845 [exp]	0	1
AT1G24420			HXXXD-type acyl-transferase fa...		Lus10025521 [exp]	2.8	0.7585
AT5G06740			Concanavalin A-like lectin pro...		Lus10029291 [exp]	3.0	0.7059
AT5G33340		CDR1	CONSTITUTIVE DISEASE RESISTANC...		Lus10002612 [exp]	4.0	0.7716
AT4G23690			Disease resistance-responsive ...		Lus10028750 [exp]	6.3	0.6554
AT1G22380		ATUGT85A3	UDP-glucosyl transferase 85A3 ...		Lus10013919 [exp]	8.3	0.7444
AT1G26730			EXS (ERD1/XPR1/SYG1) family pr...		Lus10004284 [exp]	9.6	0.7341
AT1G22400		ATUGT85A1, UGT8...	ARABIDOPSIS THALIANA UDP-GLUCO...		Lus10013920 [exp]	11.2	0.7315
AT2G16730		BGAL13	beta-galactosidase 13, glycosy...		Lus10014126 [exp]	12.2	0.7315
AT5G45670			GDSL-like Lipase/Acylhydrolase...		Lus10015241 [exp]	13.2	0.7315
AT5G20260			Exostosin family protein (.1)		Lus10039980 [exp]	14.1	0.7315

Compare expression of checked genes

Lus10029845 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.