Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT5G46940 66 / 2e-13 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1) AT5G64620 63 / 2e-12 ATC/VIF2, C/VIF2 cell wall / vacuolar inhibitor of fructosidase 2 (.1) AT5G46930 55 / 2e-09 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1) AT4G02250 52 / 2e-08 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1) AT5G46950 51 / 4e-08 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1) AT5G46970 50 / 8e-08 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1) AT1G70720 49 / 4e-07 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1) AT5G38610 49 / 5e-07 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1) AT3G36659 48 / 8e-07 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1) AT1G47960 48 / 9e-07 ATC/VIF1, C/VIF1 cell wall / vacuolar inhibitor of fructosidase 1 (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10020664 [exp] 291 / 4e-102 AT5G64620 67 / 2e-14 cell wall / vacuolar inhibitor of fructosidase 2 (.1) Lus10015199 [exp] 168 / 6e-53 AT5G46940 67 / 8e-14 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1) Lus10031483 [exp] 162 / 1e-50 AT5G46940 64 / 8e-13 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1) Lus10008201 [exp] 65 / 3e-13 AT4G02250 113 / 3e-32 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1) Lus10001464 [exp] 64 / 1e-12 AT4G02250 112 / 1e-31 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1) Lus10000822 [exp] 60 / 3e-11 AT1G47960 113 / 1e-31 cell wall / vacuolar inhibitor of fructosidase 1 (.1) Lus10003530 [exp] 58 / 1e-10 AT1G47960 91 / 5e-23 cell wall / vacuolar inhibitor of fructosidase 1 (.1) Lus10002933 [exp] 57 / 2e-10 AT1G47960 89 / 3e-22 cell wall / vacuolar inhibitor of fructosidase 1 (.1) Lus10019498 [exp] 56 / 1e-09 AT5G46970 87 / 1e-21 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.006G134900 [exp] 89 / 4e-22 AT5G64620 76 / 2e-17 cell wall / vacuolar inhibitor of fructosidase 2 (.1) Potri.005G023201 [exp] 74 / 1e-15 AT5G46940 45 / 2e-05 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1) Potri.005G023100 [exp] 74 / 1e-15 AT5G46940 45 / 2e-05 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1) Potri.005G023050 [exp] 71 / 2e-14 AT5G46940 45 / 2e-05 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1) Potri.003G086500 [exp] 69 / 2e-14 AT5G46940 119 / 6e-34 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1) Potri.009G083500 [exp] 67 / 4e-14 AT1G47960 114 / 7e-32 cell wall / vacuolar inhibitor of fructosidase 1 (.1) Potri.003G086600 [exp] 68 / 5e-14 AT5G38610 123 / 2e-35 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1) Potri.004G016500 [exp] 67 / 7e-14 AT4G02250 73 / 2e-16 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1) Potri.014G044100 [exp] 65 / 3e-13 AT5G46940 111 / 3e-31 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1) Potri.001G127500 [exp] 61 / 1e-11 AT4G02250 98 / 3e-26 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF04043 [flax] [poplar] PMEI Plant invertase/pectin methylesterase inhibitor
Representative CDS sequence Show only first row Show all	>Lus10029877 pacid=23159790 polypeptide=Lus10029877 locus=Lus10029877.g ID=Lus10029877.BGIv1.0 annot-version=v1.0 ATGAATTCTCCACCCTTCACATTCCTACTTCTACTAACACTCATCACCACCACCACCACCACAACATCAAATGCTCACGAATCCCCATCGGCATCACCAC AGCCTTCAACGGCGGCCAACAACCAACAGCCCCTCCTAACCAAAGCCTGCGAGTCTACCCCACTCTACAAGGACCTCTGCATCTCGTCCCTAAGCACCTA CCCCGAGTCGGAGGTGAAAGACCTCAACGGGCTAGCAAAGTACGCGATCGAGATGGTATCGAAGAAGGCCGCGTTGACCCACAAGCAGATTGAGGACATG GAATCCAAGTCCGAGGACGAGGCCACCAAGAAGAAGCTCAATGACTGCGAAGAAATGTACGCCGACATCAGCGATACCCTGAAGGATTCCGTGGAGTCTC TAGATAAGAAGGCTTACGACGACGTCATCGAGTCGTTAACGGCGGCGATGAATGACGCTGAGGCTTGTGAGGATGGGTTCAAGGAGCCTCCCGTCGTTAA GTCGCCATTGACTGACGTTAATGAGATGTTTACTAAGTTTTGTAGCATTTGCTTGGCCATCACTAGCACTGTTGACAAATAG
AA sequence Show only first row Show all	>Lus10029877 pacid=23159790 polypeptide=Lus10029877 locus=Lus10029877.g ID=Lus10029877.BGIv1.0 annot-version=v1.0 MNSPPFTFLLLLTLITTTTTTTSNAHESPSASPQPSTAANNQQPLLTKACESTPLYKDLCISSLSTYPESEVKDLNGLAKYAIEMVSKKAALTHKQIEDM ESKSEDEATKKKLNDCEEMYADISDTLKDSVESLDKKAYDDVIESLTAAMNDAEACEDGFKEPPVVKSPLTDVNEMFTKFCSICLAITSTVDK

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT5G64620		ATC/VIF2, C/VIF...	cell wall / vacuolar inhibitor...		Lus10029877 [exp]	0	1
					Lus10040805 [exp]	8.0	0.6777
AT4G29530			Pyridoxal phosphate phosphatas...		Lus10008573 [exp]	12.3	0.6429
					Lus10022836 [exp]	23.0	0.6403
AT5G50300		ATAZG2	ARABIDOPSIS THALIANA AZA-GUANI...		Lus10034287 [exp]	26.7	0.5883
AT5G59100			Subtilisin-like serine endopep...		Lus10040751 [exp]	27.1	0.5933
AT4G25300			2-oxoglutarate (2OG) and Fe(II...		Lus10040106 [exp]	28.3	0.6268
					Lus10025813 [exp]	34.9	0.6256
AT4G19770			Glycosyl hydrolase family prot...		Lus10003408 [exp]	37.7	0.5852
AT1G69990			Leucine-rich repeat protein ki...		Lus10041486 [exp]	41.1	0.5874
AT3G45140		ATLOX2, LOX2	ARABIODOPSIS THALIANA LIPOXYGE...		Lus10031236 [exp]	43.6	0.5756

Compare expression of checked genes

Lus10029877 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.